


| Basic Information | |
|---|---|
| Family ID | F101728 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | AELARLCDCVLAVRQGRIAATLDRAAGLDEPKLRAAIGG |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 96.08 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.118 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 19.40% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02653 | BPD_transp_2 | 92.16 |
| PF13407 | Peripla_BP_4 | 1.96 |
| PF07883 | Cupin_2 | 0.98 |
| PF14294 | DUF4372 | 0.98 |
| PF03979 | Sigma70_r1_1 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.06 % |
| Unclassified | root | N/A | 2.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000858|JGI10213J12805_10276716 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101673356 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300004152|Ga0062386_100514187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 973 | Open in IMG/M |
| 3300005168|Ga0066809_10048875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300005177|Ga0066690_11044476 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005332|Ga0066388_103828488 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005468|Ga0070707_101042397 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005546|Ga0070696_100497856 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300005575|Ga0066702_10378240 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005602|Ga0070762_10812374 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005713|Ga0066905_101368106 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005764|Ga0066903_104045630 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005764|Ga0066903_104972742 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300006049|Ga0075417_10259302 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006051|Ga0075364_11206417 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006173|Ga0070716_100929711 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006845|Ga0075421_102737667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300006853|Ga0075420_100845681 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300007076|Ga0075435_100721514 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300007076|Ga0075435_101469694 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300009088|Ga0099830_10632545 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300009090|Ga0099827_11375963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300009094|Ga0111539_10368356 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300009100|Ga0075418_11706272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300009101|Ga0105247_11393618 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009553|Ga0105249_10281503 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300010037|Ga0126304_10567971 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300010047|Ga0126382_10004956 | All Organisms → cellular organisms → Bacteria | 5962 | Open in IMG/M |
| 3300010047|Ga0126382_11449088 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010321|Ga0134067_10314308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300010362|Ga0126377_12177830 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010362|Ga0126377_13363723 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010376|Ga0126381_102958700 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010398|Ga0126383_11510446 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300010398|Ga0126383_13498700 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300011269|Ga0137392_10426268 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300011271|Ga0137393_11136363 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012198|Ga0137364_11058601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 611 | Open in IMG/M |
| 3300012205|Ga0137362_10959169 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012532|Ga0137373_11264274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300012582|Ga0137358_10781615 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012929|Ga0137404_11073204 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012944|Ga0137410_10682361 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300012944|Ga0137410_11420035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 604 | Open in IMG/M |
| 3300012957|Ga0164303_10514338 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300012958|Ga0164299_10740144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300012960|Ga0164301_11069954 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012971|Ga0126369_11848648 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012987|Ga0164307_10660076 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300016270|Ga0182036_10756269 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300016294|Ga0182041_11116943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 716 | Open in IMG/M |
| 3300018076|Ga0184609_10293085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 761 | Open in IMG/M |
| 3300018078|Ga0184612_10209689 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300019356|Ga0173481_10477297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300020579|Ga0210407_11069535 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300021361|Ga0213872_10120413 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300021401|Ga0210393_11152074 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021405|Ga0210387_10276252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1474 | Open in IMG/M |
| 3300021478|Ga0210402_10302685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1480 | Open in IMG/M |
| 3300021560|Ga0126371_12461433 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021560|Ga0126371_13399631 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300022694|Ga0222623_10114365 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300025915|Ga0207693_11161157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 584 | Open in IMG/M |
| 3300025916|Ga0207663_10268845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1262 | Open in IMG/M |
| 3300025945|Ga0207679_11477025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300025960|Ga0207651_10543357 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300026067|Ga0207678_11471128 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300026121|Ga0207683_12160236 | Not Available | 505 | Open in IMG/M |
| 3300026361|Ga0257176_1031727 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300027575|Ga0209525_1090147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 729 | Open in IMG/M |
| 3300027880|Ga0209481_10485647 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027908|Ga0209006_11277776 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300028784|Ga0307282_10552181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300028793|Ga0307299_10380354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300028811|Ga0307292_10229727 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300028878|Ga0307278_10525603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300028906|Ga0308309_10603469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 953 | Open in IMG/M |
| 3300031226|Ga0307497_10738995 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031546|Ga0318538_10795328 | Not Available | 513 | Open in IMG/M |
| 3300031561|Ga0318528_10568614 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031573|Ga0310915_10452395 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031640|Ga0318555_10807978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031668|Ga0318542_10611214 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031668|Ga0318542_10718489 | Not Available | 523 | Open in IMG/M |
| 3300031747|Ga0318502_10059125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2038 | Open in IMG/M |
| 3300031747|Ga0318502_10563845 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300031771|Ga0318546_10056453 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300031778|Ga0318498_10086964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1412 | Open in IMG/M |
| 3300031779|Ga0318566_10306413 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031793|Ga0318548_10639742 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031805|Ga0318497_10652063 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031819|Ga0318568_10379332 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300031845|Ga0318511_10003028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4867 | Open in IMG/M |
| 3300031890|Ga0306925_11512692 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031910|Ga0306923_11111676 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031910|Ga0306923_11298164 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300031942|Ga0310916_10606059 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031959|Ga0318530_10044483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1649 | Open in IMG/M |
| 3300032055|Ga0318575_10164273 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032059|Ga0318533_11000581 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300032782|Ga0335082_11652843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 514 | Open in IMG/M |
| 3300033233|Ga0334722_10298660 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10213J12805_102767162 | 3300000858 | Soil | ALVHSSDLGELARLCDSVLAVRHGRIAATLDRAAGLDEPKLRAAIGG* |
| JGIcombinedJ26739_1016733562 | 3300002245 | Forest Soil | RLCDRVLAVRQGRIAATLERGASLDESTLSSAIGG* |
| Ga0062386_1005141872 | 3300004152 | Bog Forest Soil | VRGGGGALINSSDLGELARLCGRVLAVRRDRIVATLDRAAGIDEAKLRAAIGG* |
| Ga0066809_100488752 | 3300005168 | Soil | SSDLGELARLCDAILPVRRDRIVGRLDRAQGLDERELRAAIGG* |
| Ga0066690_110444762 | 3300005177 | Soil | ALVNSSDLGELARLCDAILPVRRDRIVGRLDRSQGLNERELRAAIGG* |
| Ga0066388_1038284882 | 3300005332 | Tropical Forest Soil | LTELARLCDAVLAVRYGSIVARLERADGLDEPKLRAAIGA* |
| Ga0070707_1010423972 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LGELTRLCDRVLAVQQGRIAATLDRPASLDEPKLRNAIGG* |
| Ga0070696_1004978561 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LVNSTDLAELARLCDRVLAVRQGRVATTLTRADGLDESKLRAAIGG* |
| Ga0066702_103782401 | 3300005575 | Soil | ELARLCDRVLAVRQGRITASLDRRAGIDESKLRNAIGG* |
| Ga0070762_108123741 | 3300005602 | Soil | LMSSSDLGEMTHLCDSVLAVRQGRITARLERGAGLDEPQLRAAIGG* |
| Ga0066905_1013681061 | 3300005713 | Tropical Forest Soil | GGALIHSSDLGELARLCDRVLAVRQGRIAATLDRPASLDEPKLRNAIGG* |
| Ga0066903_1040456301 | 3300005764 | Tropical Forest Soil | RLCDGVLAVRQGRIAATLGRASGLDEPQLRAAVGG* |
| Ga0066903_1049727421 | 3300005764 | Tropical Forest Soil | LIHSSDLGELARLCDRVLAVRQGRIAAALDRPASLDESTLNKAIGG* |
| Ga0075417_102593022 | 3300006049 | Populus Rhizosphere | LGELARLCDRVLAVQQGRITASHDRRAGMDEAKLRSAIGG* |
| Ga0075364_112064172 | 3300006051 | Populus Endosphere | LSELARLCDAVLAVRHGRIMAAIDCSAGFDESKLRAAIGG* |
| Ga0070716_1009297112 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GGALIHSSDLGELARLCDRVLAVRQGRIAATLERPASLDEPTLSSAIGG* |
| Ga0075421_1027376672 | 3300006845 | Populus Rhizosphere | HSSDLGELARLCDRVLAVRQGRIAATFDRGDGVDEGKLRTAIGG* |
| Ga0075420_1008456811 | 3300006853 | Populus Rhizosphere | RDVVARGGGALIQSSDLGELARLCDCVLAVRQGRIVAGLDRTAGIDEPKLRSAIGG* |
| Ga0075435_1007215141 | 3300007076 | Populus Rhizosphere | SRLCDGVLAVRHGRIAATLDRASGLDEPALRAAIGG* |
| Ga0075435_1014696942 | 3300007076 | Populus Rhizosphere | ALIYSSDLGELARLCDRVLAVRQGRVMASLDRRAGIDESKLRNAIGG* |
| Ga0099830_106325452 | 3300009088 | Vadose Zone Soil | GGGSCALIKSSDLGELARLCGTVLAVRQDRIVATLDRGSGLDEPKLRAAIGG* |
| Ga0099827_113759632 | 3300009090 | Vadose Zone Soil | AELARLCDCVLAVRQGRIAATLDRAAGLDEPKLRAAIGG* |
| Ga0111539_103683561 | 3300009094 | Populus Rhizosphere | DLGELARLCDRVLAVRQGRIAATFDRGDGVDEGKLRTAIGG* |
| Ga0075418_117062721 | 3300009100 | Populus Rhizosphere | ARGGGALINSSDLGELARLCDSVLAVRQGRIAASLDRAQGLDEPKLRAAIGG* |
| Ga0105247_113936181 | 3300009101 | Switchgrass Rhizosphere | FVTRGGGALISSSDLGELARLCDSVLAVRQGRIITTLDRADRLDEARLRTAIGG* |
| Ga0105249_102815034 | 3300009553 | Switchgrass Rhizosphere | AELTRLCDSVLAVRQGRIAATLDRTTGLDEPTLRAAIGG* |
| Ga0126304_105679712 | 3300010037 | Serpentine Soil | FVARGGGALINSSDLGELARLCDSVLAVRQGRIAASLDRAQGLDEPKLRAAIGG* |
| Ga0126382_100049566 | 3300010047 | Tropical Forest Soil | AELARLCDCVLAVRQRRVVATLDRADGLDEVKLRAAIGG* |
| Ga0126382_114490882 | 3300010047 | Tropical Forest Soil | ARLCDRVLAVRQGRIASALERPASLDEPELRNAIGG* |
| Ga0134067_103143082 | 3300010321 | Grasslands Soil | SSDLGELARLCDRVLAVRQGRITASLDRRAGIDESKLRNAIGG* |
| Ga0126377_121778301 | 3300010362 | Tropical Forest Soil | RGGGALIHSSDLGELARLCDRVLAVRQGRIAAALERPASRDEPTLSSAIGG* |
| Ga0126377_133637232 | 3300010362 | Tropical Forest Soil | ALLNSSDLGELARLCDRVLAVRQGRIAATLDRAQGLDEPKLQAAIGG* |
| Ga0126381_1029587001 | 3300010376 | Tropical Forest Soil | ELARLCDRVLAVRQGRIAATLDRPASLDESTLNNAIGG* |
| Ga0126383_115104462 | 3300010398 | Tropical Forest Soil | LCDRVLAVRQGRIAAALDRPTSLDEPTLRNAIGG* |
| Ga0126383_134987002 | 3300010398 | Tropical Forest Soil | DLGELARLCDRVLAVRQGRIAAALERPASRDEPTLSSAIGG* |
| Ga0137392_104262681 | 3300011269 | Vadose Zone Soil | ELARLCDCVLAVRQGRIAATLDRACGLDEPRLRAAIGG* |
| Ga0137393_111363632 | 3300011271 | Vadose Zone Soil | ALINSSDLGELARLCDCVLAVRQGRIAASLDRAQGLDEPKLRAAIGG* |
| Ga0137364_110586012 | 3300012198 | Vadose Zone Soil | FVGSGGGALVHSSDLGQLARLCDRVLAVRQQRIAAILDRAQGLDEPKLHAMIGG* |
| Ga0137362_109591691 | 3300012205 | Vadose Zone Soil | ARLCDRVLAVRQGRIAATLERPASLDEPTLSSAIGG* |
| Ga0137373_112642742 | 3300012532 | Vadose Zone Soil | GALMHSSDLGELTRLCDRVLAVRQGRIAATLDRPASLDEPKLRNAIGG* |
| Ga0137358_107816152 | 3300012582 | Vadose Zone Soil | DLGELARLCDRVLAVRQGRIAATLERPASLDEPTLSSAIGG* |
| Ga0137404_110732042 | 3300012929 | Vadose Zone Soil | RLCDCVLAVRQGRIAATLDHTDGLDEPRLRAAIGG* |
| Ga0137410_106823612 | 3300012944 | Vadose Zone Soil | GELARLCDCVLAVRQGRIAATLDRVGGLDESKLRAAIGG* |
| Ga0137410_114200352 | 3300012944 | Vadose Zone Soil | TRGGGVLINSSDLGELARLCDSVLAVRQGRIAATLDRAAGLGEPKLRAAIGG* |
| Ga0164303_105143382 | 3300012957 | Soil | SDLAELGRLCDAVLAVRHSSIVARLERADGLDEPKLRAAIGA* |
| Ga0164299_107401441 | 3300012958 | Soil | ELTRLCDSVLAVRQGRIAATLDRTTGLDEPTLRAAIGG* |
| Ga0164301_110699541 | 3300012960 | Soil | LAELTRLCDSVLAVRQGRIAATLDRTAGLEEPTLRAAIGG* |
| Ga0126369_118486481 | 3300012971 | Tropical Forest Soil | GGALIHSSDLGELARLCDRVLAVRQGRIAAALDRSASLDEPELRNAIGG* |
| Ga0164307_106600761 | 3300012987 | Soil | RLCDSVLAVRQGRIAATLDRTTGLDEPTLRAAIGG* |
| Ga0182036_107562692 | 3300016270 | Soil | SDLGELARLCDRVLAMRHGRVTATVDRGAALDESKLRSAIGG |
| Ga0182041_111169431 | 3300016294 | Soil | VARGGGALIHSSDLGELARLCDRVLAVRQGRIAAALERPASLDEPTLSSAIGG |
| Ga0184609_102930851 | 3300018076 | Groundwater Sediment | ALINSSDLGELARLCDTVLAVRQGRIAASLDRAQGLDEPRLRAAIGG |
| Ga0184612_102096892 | 3300018078 | Groundwater Sediment | DLDELARLCDSVLAVRQGRIAAVLDRSSGLDEPKLCAAIGG |
| Ga0173481_104772971 | 3300019356 | Soil | LAELSRLCDGVLAVRQGRIAATLDRASGLDEPALRAAIGG |
| Ga0210407_110695351 | 3300020579 | Soil | ELGRLCDAVLAVRHGSIVARLERADGLDEPRLRAAIGA |
| Ga0213872_101204131 | 3300021361 | Rhizosphere | GALIASSDLIELARLCDGVLAVRQGAITVRLDRAVGLDETKLRAAIGA |
| Ga0210393_111520741 | 3300021401 | Soil | FARRGGAALVNSSDLGELARLCDAILPVRRDRIVGRLDRAQGLDERELRAAIGG |
| Ga0210387_102762521 | 3300021405 | Soil | ARRGGAALVNSSDLGELARLCDAILPVRRDRIVGRLDRAQGLDERELRAAIGG |
| Ga0210402_103026853 | 3300021478 | Soil | RLCDAVLAVRQGSVAARLERTDGLDEPKLRAAIGA |
| Ga0126371_124614331 | 3300021560 | Tropical Forest Soil | RLCDAVLAVRQGAITARLDRAQGLDEATLRTAIGA |
| Ga0126371_133996312 | 3300021560 | Tropical Forest Soil | DVVARGGGALTHSSDLGELARLCDRVLAVRQGRIAATLDRPASLDESTLNNAIGG |
| Ga0222623_101143651 | 3300022694 | Groundwater Sediment | LSRLCDGVLAVRQGRIAATLDRASGLDEPALRAAIGG |
| Ga0207693_111611571 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGALISSSDLGELARLCDSVLAVRQGRIVTTLDRADRLDEARLRTAIGG |
| Ga0207663_102688453 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAALVNSSDLGELARLCDAILPVRRDRIVGRLDRAQGLDERELRAAIGG |
| Ga0207679_114770251 | 3300025945 | Corn Rhizosphere | TRLCDSVLAVRQGRIAATLDRTTGLDEPTLRAAIGG |
| Ga0207651_105433571 | 3300025960 | Switchgrass Rhizosphere | ELTRLCDSVLAVRQGRIAATLDRTTGLDEPTLRAAIGG |
| Ga0207678_114711281 | 3300026067 | Corn Rhizosphere | RLCDSVLAVRQGRIAATLDRTTGLDEPKLRAAIGG |
| Ga0207683_121602361 | 3300026121 | Miscanthus Rhizosphere | AELTRLRDSVLAVRQGRIAATLDRTAGLEEPTLRAAIGG |
| Ga0257176_10317271 | 3300026361 | Soil | DLAELARLCDRVLAVRQGRITATLDRSAGIDEPTLRSAIGG |
| Ga0209525_10901472 | 3300027575 | Forest Soil | MSSSDLGELIHLCDSVLAVRAGRITARLERGAGLGEPQLRAAIGG |
| Ga0209481_104856472 | 3300027880 | Populus Rhizosphere | AELARLCDAVLAVRQGRITAALDRSVGFDEPKLRAAIGG |
| Ga0209006_112777762 | 3300027908 | Forest Soil | VNSSDLGELARLCDAILPVRRDRIVGRLDRAQGLDERELRAAIGG |
| Ga0307282_105521812 | 3300028784 | Soil | LSRLCDGVLAVRQGRIAATLDRASGLDEPTLRAAIGG |
| Ga0307299_103803541 | 3300028793 | Soil | DLAELSRLCDCVLAVRQGRIAATLDRASGLDEPALRAAIGG |
| Ga0307292_102297271 | 3300028811 | Soil | ALIYSSDLGELARLCDRVLAVQQGRITASHDRRAGMDETKLRSAIGG |
| Ga0307278_105256032 | 3300028878 | Soil | DLAELSRLCDGVLAVRQGRIAATLDRASGLDEPTLRAAIGG |
| Ga0308309_106034692 | 3300028906 | Soil | IKSSDLGELSRLCGSVLAVRRHRIVASIDRTAGLDEPRLRAEIGG |
| Ga0307497_107389952 | 3300031226 | Soil | ARLCDCVLAVRQGRIAATLDRAGGLGEPKLRAAIGG |
| Ga0318538_107953282 | 3300031546 | Soil | VKSSELGELAHLCGTVLAVRRDRIVATIDRAAGLDERRLRAEIGG |
| Ga0318528_105686141 | 3300031561 | Soil | GELARLCDRVLAMRHGRVTATVDRGAALDESKLRSAIGG |
| Ga0310915_104523951 | 3300031573 | Soil | LARLCDRVLAVRQGRIAAALERPASLDEPTLSSAIGG |
| Ga0318555_108079781 | 3300031640 | Soil | RDFIHRGGGTLIASSDLTELARLCDAVLAVRYGSIVARLERADGLDEPKLRAAIGA |
| Ga0318542_106112142 | 3300031668 | Soil | RHFVERGNAALVKSSELGELTHLCGTVLAVRRERIVATIDRAAGLDERRLRAEIGG |
| Ga0318542_107184891 | 3300031668 | Soil | HGLIRDFIHRGGGTLIASTDLTELARLCDAVLAVRYGSIVARLERANGLDEPKLRAAIGA |
| Ga0318502_100591253 | 3300031747 | Soil | IYSSDLGELARLCDRVLAMRHGRVTATVDRGAALDESKLRSAIGG |
| Ga0318502_105638451 | 3300031747 | Soil | LGELARLCDRVLAVRQGRIAATLDRPASLDESTLNNAIGG |
| Ga0318546_100564534 | 3300031771 | Soil | GGGALIHSSDLGELARLCDRVLAVRQGRIAATLDRPASLDESTLNNAIGG |
| Ga0318498_100869643 | 3300031778 | Soil | IHSSDLGELARLCDRVLAVRQGRVAAALDRPASLDESTLNNAIGG |
| Ga0318566_103064132 | 3300031779 | Soil | ARLCERVLAVHKGRIAAVLDRDGGLDETQLRAAIGG |
| Ga0318548_106397421 | 3300031793 | Soil | DLGELARLCDRVLAVRQGRIAAALERPASLDEPTLSSAIGG |
| Ga0318497_106520632 | 3300031805 | Soil | IHSSDLGELARLCDRVLAVRQGRIAAALERPVSLDEPTLSSAIGG |
| Ga0318568_103793322 | 3300031819 | Soil | LTRLCESVLAVHGNRIVARLERSGGLDEPKLRAAIGG |
| Ga0318511_100030281 | 3300031845 | Soil | DLGELARLCDRVLAVRQGRIAATLDRPASLDESTLNNAIGG |
| Ga0306925_115126921 | 3300031890 | Soil | ELGELARLCGVVHVVRRDRIVASLGRADGLNEPKLHAAIGG |
| Ga0306923_111116762 | 3300031910 | Soil | ARLCDRVLAVRQGRIAAALERPASLDEPTLSSAIGG |
| Ga0306923_112981642 | 3300031910 | Soil | ARLCDRVLAMRHGRVTATVDRGAALDESKLRSAIGG |
| Ga0310916_106060592 | 3300031942 | Soil | GGGALIHSSDLGELARLCDRVLAVRQGRIAAALERPASLDEPTLSSAIGG |
| Ga0318530_100444833 | 3300031959 | Soil | LGELARLCDRVLAVRQGRVAAALDRPASLDESTLNNAIGG |
| Ga0318575_101642731 | 3300032055 | Soil | LIRDFAGSGRAALMSSSDLGKLTRLCESVLAVHGNRIVARLERSGGLDEPKLRAAIGG |
| Ga0318533_110005812 | 3300032059 | Soil | LGELTHLCGTVLAVRRERIVVTIDRAAGLDERRLRADIGG |
| Ga0335082_116528432 | 3300032782 | Soil | AARGGGVLVNASDLSELVRLCDTVLALRQGRITARMDRAEGLDEKRLYAAIGG |
| Ga0334722_102986601 | 3300033233 | Sediment | DLGELARLCDGVLAVRQGRIAASLDRASGLDEPRLRAAIGG |
| ⦗Top⦘ |