


| Basic Information | |
|---|---|
| Family ID | F101613 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MARKTGPTISQEECYPLADEPVREELDDARLLDLDVEQESPFLR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 36.63 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 89.22 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.784 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.745 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.471 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 0.00% Coil/Unstructured: 77.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02875 | Mur_ligase_C | 9.80 |
| PF12867 | DinB_2 | 7.84 |
| PF08245 | Mur_ligase_M | 6.86 |
| PF01098 | FTSW_RODA_SPOVE | 1.96 |
| PF01839 | FG-GAP | 0.98 |
| PF08922 | DUF1905 | 0.98 |
| PF01988 | VIT1 | 0.98 |
| PF01381 | HTH_3 | 0.98 |
| PF04101 | Glyco_tran_28_C | 0.98 |
| PF00293 | NUDIX | 0.98 |
| PF00563 | EAL | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 1.96 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.98 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.98 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.98 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.98 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.98 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.78 % |
| Unclassified | root | N/A | 39.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001915|JGI24741J21665_1051852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300002558|JGI25385J37094_10059046 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300004080|Ga0062385_10010182 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
| 3300004633|Ga0066395_10553313 | Not Available | 669 | Open in IMG/M |
| 3300005174|Ga0066680_10065803 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300005290|Ga0065712_10508353 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005328|Ga0070676_11297428 | Not Available | 556 | Open in IMG/M |
| 3300005332|Ga0066388_105030531 | Not Available | 672 | Open in IMG/M |
| 3300005454|Ga0066687_10025101 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
| 3300005456|Ga0070678_101748006 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005535|Ga0070684_101623106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 610 | Open in IMG/M |
| 3300005569|Ga0066705_10314198 | Not Available | 992 | Open in IMG/M |
| 3300005578|Ga0068854_101886715 | Not Available | 549 | Open in IMG/M |
| 3300005586|Ga0066691_10698184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300005586|Ga0066691_10919645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300005598|Ga0066706_10137926 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300005718|Ga0068866_10057050 | Not Available | 2010 | Open in IMG/M |
| 3300005834|Ga0068851_10674984 | Not Available | 634 | Open in IMG/M |
| 3300006031|Ga0066651_10716486 | Not Available | 538 | Open in IMG/M |
| 3300006047|Ga0075024_100657181 | Not Available | 570 | Open in IMG/M |
| 3300006050|Ga0075028_100383780 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300006052|Ga0075029_100233486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300006052|Ga0075029_100477985 | Not Available | 820 | Open in IMG/M |
| 3300006102|Ga0075015_100825386 | Not Available | 558 | Open in IMG/M |
| 3300006162|Ga0075030_101344798 | Not Available | 560 | Open in IMG/M |
| 3300006175|Ga0070712_101311867 | Not Available | 631 | Open in IMG/M |
| 3300006176|Ga0070765_100021534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4835 | Open in IMG/M |
| 3300009089|Ga0099828_11302463 | Not Available | 643 | Open in IMG/M |
| 3300009093|Ga0105240_11769744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300009148|Ga0105243_12122171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300009176|Ga0105242_10089957 | Not Available | 2581 | Open in IMG/M |
| 3300010301|Ga0134070_10223183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300010337|Ga0134062_10100501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
| 3300010360|Ga0126372_12793316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300010366|Ga0126379_10229708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1810 | Open in IMG/M |
| 3300010397|Ga0134124_12745571 | Not Available | 536 | Open in IMG/M |
| 3300011119|Ga0105246_10484744 | Not Available | 1047 | Open in IMG/M |
| 3300012198|Ga0137364_10163724 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300012199|Ga0137383_10841945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300012353|Ga0137367_10679121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300012363|Ga0137390_10461646 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300012917|Ga0137395_10863804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300012924|Ga0137413_10492436 | Not Available | 900 | Open in IMG/M |
| 3300012929|Ga0137404_11079716 | Not Available | 736 | Open in IMG/M |
| 3300012951|Ga0164300_11025312 | Not Available | 533 | Open in IMG/M |
| 3300012988|Ga0164306_11986148 | Not Available | 506 | Open in IMG/M |
| 3300013306|Ga0163162_10719243 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300013308|Ga0157375_11205101 | Not Available | 888 | Open in IMG/M |
| 3300014838|Ga0182030_11278617 | Not Available | 620 | Open in IMG/M |
| 3300014968|Ga0157379_11779097 | Not Available | 605 | Open in IMG/M |
| 3300015241|Ga0137418_10838567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300017823|Ga0187818_10216927 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300017943|Ga0187819_10490524 | Not Available | 701 | Open in IMG/M |
| 3300017973|Ga0187780_10312245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300017974|Ga0187777_10520147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300017975|Ga0187782_11237463 | Not Available | 585 | Open in IMG/M |
| 3300017999|Ga0187767_10241166 | Not Available | 591 | Open in IMG/M |
| 3300017999|Ga0187767_10339599 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018047|Ga0187859_10826274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300018061|Ga0184619_10066953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1582 | Open in IMG/M |
| 3300018482|Ga0066669_10008145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5122 | Open in IMG/M |
| 3300020583|Ga0210401_10269401 | Not Available | 1563 | Open in IMG/M |
| 3300021171|Ga0210405_10193051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1614 | Open in IMG/M |
| 3300021180|Ga0210396_11009500 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300021404|Ga0210389_11178076 | Not Available | 590 | Open in IMG/M |
| 3300021404|Ga0210389_11408155 | Not Available | 532 | Open in IMG/M |
| 3300021432|Ga0210384_10991881 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300021477|Ga0210398_10624723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300021477|Ga0210398_11110190 | Not Available | 628 | Open in IMG/M |
| 3300022557|Ga0212123_10685334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300022726|Ga0242654_10083245 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300025625|Ga0208219_1125681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300025922|Ga0207646_11019256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300025929|Ga0207664_10639990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300026298|Ga0209236_1238967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300026306|Ga0209468_1106954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300026315|Ga0209686_1006331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5141 | Open in IMG/M |
| 3300026323|Ga0209472_1100039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300026324|Ga0209470_1157464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300026333|Ga0209158_1300016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300026334|Ga0209377_1232423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300026527|Ga0209059_1144965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300027641|Ga0208827_1040996 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300027874|Ga0209465_10161321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300027908|Ga0209006_11102035 | Not Available | 626 | Open in IMG/M |
| 3300028906|Ga0308309_10208632 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300030659|Ga0316363_10321212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300031720|Ga0307469_11277480 | Not Available | 696 | Open in IMG/M |
| 3300031740|Ga0307468_100050752 | Not Available | 2164 | Open in IMG/M |
| 3300031740|Ga0307468_102409353 | Not Available | 514 | Open in IMG/M |
| 3300031820|Ga0307473_11092659 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031823|Ga0307478_10050019 | Not Available | 3097 | Open in IMG/M |
| 3300031954|Ga0306926_12699876 | Not Available | 539 | Open in IMG/M |
| 3300032180|Ga0307471_100703403 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300032205|Ga0307472_100789433 | Not Available | 866 | Open in IMG/M |
| 3300032783|Ga0335079_11786298 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032805|Ga0335078_10585775 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300032805|Ga0335078_11259210 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032828|Ga0335080_10597556 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300032897|Ga0335071_11614863 | Not Available | 593 | Open in IMG/M |
| 3300033158|Ga0335077_10639377 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24741J21665_10518522 | 3300001915 | Corn Rhizosphere | MARKNGPTILQEELYPPPSAGPREEVEDARLLDLEAEQESPFLRGQK |
| JGI25385J37094_100590461 | 3300002558 | Grasslands Soil | MARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEESPFL |
| Ga0062385_100101821 | 3300004080 | Bog Forest Soil | MARKFGSTISQEELYPPPDERVREEMDDARLLDLDAEQESPFLRGQKR |
| Ga0066395_105533131 | 3300004633 | Tropical Forest Soil | MARKSSPTIVQEELYPPPGEPEREVLDDARLLDLDVEEES |
| Ga0066680_100658031 | 3300005174 | Soil | MARKSSPTISQDELYPPSEEFAREEIEDARLLDLDVEQESPFL |
| Ga0065712_105083531 | 3300005290 | Miscanthus Rhizosphere | MARKGSPTISQEELYPPGEEFVRPALDDTRGLDLDVEEESPFLRA |
| Ga0070676_112974282 | 3300005328 | Miscanthus Rhizosphere | MARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEA |
| Ga0066388_1050305312 | 3300005332 | Tropical Forest Soil | MARKNGPSILQEELYPPPAPPVREEIDDTRLVDLDVEQESPFLRGQK |
| Ga0066687_100251011 | 3300005454 | Soil | MARKSSPTISQEELYPPGEESVRPDVDDARVLDLEAEEESPFLRGQ |
| Ga0070678_1017480063 | 3300005456 | Miscanthus Rhizosphere | MARKSGPTISQEDLYPLADEPGREDARLLDLDVEQEPPFLRVQKRV |
| Ga0070684_1016231061 | 3300005535 | Corn Rhizosphere | MARKNGPSIVQEELYPPPAPPVREEIDDARLLDLDVEQESPFLRGQKRVPV |
| Ga0066705_103141982 | 3300005569 | Soil | MARKGSPTISQEELYPSGEEFVRPALDDTRGLDLDVEEES |
| Ga0068854_1018867152 | 3300005578 | Corn Rhizosphere | MARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEAPFLRVQKRV |
| Ga0066691_106981842 | 3300005586 | Soil | MARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESP |
| Ga0066691_109196451 | 3300005586 | Soil | MARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEE |
| Ga0066706_101379263 | 3300005598 | Soil | MARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESPFLRAQ |
| Ga0068866_100570503 | 3300005718 | Miscanthus Rhizosphere | MARKSGPTISQEDLYPLADEPGREDSRLLDLDVEQEPPFLRVQK |
| Ga0068851_106749842 | 3300005834 | Corn Rhizosphere | MARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEAPFL |
| Ga0066651_107164862 | 3300006031 | Soil | MARKNAPTISQEELYPQSDEPTRQDLDDARLLDLDAEQESP |
| Ga0075024_1006571811 | 3300006047 | Watersheds | MARKSSPTIVQEELYPSADESVRPNLDDARMLDLDGEEESPFLRGQKR |
| Ga0075028_1003837802 | 3300006050 | Watersheds | MARKSGSTISQEELYPAAHEPARPVPDDGLDDARLLDLDVEQESPFL |
| Ga0075029_1002334861 | 3300006052 | Watersheds | MARKSGSTILQEELYPQTNEPAREEVDDARLLDLDVEQESPFLRGQKRVS |
| Ga0075029_1004779852 | 3300006052 | Watersheds | MARKASPTIEQEELPYASESVREDFDDPRRVDLDVEEESPFLRAQK |
| Ga0075015_1008253862 | 3300006102 | Watersheds | MARKNGPTISQEELYPLADEPGREEVHDARLLDLDVEQEPPFLR |
| Ga0075030_1013447981 | 3300006162 | Watersheds | MARKSSSTILQEELYPQTREPEREEVDDARLPELDVEQESP |
| Ga0070712_1013118672 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MARKSGPTISQEGLYPLAEEPGREEVNDARLLDLDVEQEPPFLRVQ |
| Ga0070765_1000215341 | 3300006176 | Soil | MARKSGSTISQEELYPPPDEPVREEVDDPRLFELDGDEEAPF |
| Ga0099828_113024631 | 3300009089 | Vadose Zone Soil | MARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEESPFLRGQKRVS |
| Ga0105240_117697442 | 3300009093 | Corn Rhizosphere | MARKNGPSIVQEELYPPPAPPVREEIDDARLLDLDVEQESPFLRGQKRV |
| Ga0105243_121221711 | 3300009148 | Miscanthus Rhizosphere | MARKNGPTILQEELYPPPSAGPREELEDARLLDLEAEQESPFLRGQK |
| Ga0105242_100899571 | 3300009176 | Miscanthus Rhizosphere | MARKSGPTISQEELYPLADEPGREEAHDARLLDLDVEQEPPFLRVQKRVS |
| Ga0134070_102231832 | 3300010301 | Grasslands Soil | MARKTPTISQEELYLQPDEPVREELDDARLLDLDAEEES |
| Ga0134062_101005013 | 3300010337 | Grasslands Soil | MARKTPTISQEESYLQPDEPVREELDDARLLDLDAEEESPFL |
| Ga0126372_127933162 | 3300010360 | Tropical Forest Soil | MARKTPTISQEELYLQPDEPVREDIDDARLLDLDAEE |
| Ga0126379_102297083 | 3300010366 | Tropical Forest Soil | MARKSSPTISQEELYSAGEEPVRPDLDDARTLDLDVEEESPFLRAQK |
| Ga0134124_127455711 | 3300010397 | Terrestrial Soil | MARKSGPTISQEELYPPSEEALRPDLDDARVLDLDVEEESPFLRG |
| Ga0105246_104847443 | 3300011119 | Miscanthus Rhizosphere | MARKSGPTISQEELYPLADEPGREEAQDARLLDLDVEQEAPFLRVQK |
| Ga0137364_101637241 | 3300012198 | Vadose Zone Soil | MARKNGPSILQEELYPPPDQPVREEMDDARLLDLDVEQESP |
| Ga0137383_108419452 | 3300012199 | Vadose Zone Soil | MARKNGPSILQEELYPPPDQPVREEMDDARLLDLDVEQES |
| Ga0137367_106791212 | 3300012353 | Vadose Zone Soil | MARKSGPTIPQEELYPSPDEPTRDDLDDARMLDLDVEQESPFLRG |
| Ga0137390_104616461 | 3300012363 | Vadose Zone Soil | MARKSSPTISQDELYPPSEEFAREDIEDARLLDLDVEQES |
| Ga0137395_108638041 | 3300012917 | Vadose Zone Soil | MARKNAPTISQEELYPQSDEPTRQDLDDARLLDLDAEQESPFLRGQ |
| Ga0137413_104924362 | 3300012924 | Vadose Zone Soil | MARKSGHTISQEELYPLADEPGREEVQDARLLDLDVEQEPP |
| Ga0137404_110797161 | 3300012929 | Vadose Zone Soil | MARKSGPTISQEELYPQTNEPGRDEAHDARMLDLDVEQEPPF |
| Ga0164300_110253121 | 3300012951 | Soil | MARKHAPTISQEELYPPPEEATREERDDARMLELDAEQ |
| Ga0164306_119861482 | 3300012988 | Soil | MARKSGPSIQQEELYPPSDEQALEGLDDSRLVDLDVEQESPF |
| Ga0163162_107192431 | 3300013306 | Switchgrass Rhizosphere | MARKSGPTISQEELYPLADEPGREEAQDARLLDLD |
| Ga0157375_112051012 | 3300013308 | Miscanthus Rhizosphere | MARKSGPTISQEDLYPLADEPGREEAHDARLLDLDVEQEPP |
| Ga0182030_112786172 | 3300014838 | Bog | MARKSGSTILQEELYPQADEPAREEVEDQRLLDLDVEQESP |
| Ga0157379_117790971 | 3300014968 | Switchgrass Rhizosphere | MARKNGPTILQEELYPPPGAAQREEVEDARLLDLEEEQESPFLR |
| Ga0137418_108385672 | 3300015241 | Vadose Zone Soil | MARKNSSTIVQEELYPLPDGPVREEMDGARLLDLDVEQESPFLRGQKR |
| Ga0187818_102169272 | 3300017823 | Freshwater Sediment | MARKGSSTISQGELYPHSDEAVREELDDARLFDLDV |
| Ga0187819_104905242 | 3300017943 | Freshwater Sediment | MARKGSSTILQEELYPQAQETGREEVDDARLLELDVEQESPF |
| Ga0187780_103122451 | 3300017973 | Tropical Peatland | MARKTGSTISQEELYPSASPPARDELDDARLVDLDVEDESPFLRGQKRV |
| Ga0187777_105201472 | 3300017974 | Tropical Peatland | MARKTGSTISQEELYPSASPPARDELDDARLVDLDVEDESPFLRGQK |
| Ga0187782_112374632 | 3300017975 | Tropical Peatland | MARKESPTILQEELYPPPDESAREDPGHVRSLDLDVEEESPFLRRQRRIP |
| Ga0187767_102411662 | 3300017999 | Tropical Peatland | MARKASSTISQEELYPQTDEPVREALDDARLLDLDVEE |
| Ga0187767_103395992 | 3300017999 | Tropical Peatland | MARKASSTISQEELYPHSDHVRADLDDARLVDLDVEEES |
| Ga0187859_108262742 | 3300018047 | Peatland | MARKSGSTISQEELYPQADESTRQELDDAHRLDLDVDDESPFLRGQ |
| Ga0184619_100669533 | 3300018061 | Groundwater Sediment | MARKNGPTISQEELYPQSDEPTRQDLDDARLLDLDAEQESPFLRGQK |
| Ga0066669_100081451 | 3300018482 | Grasslands Soil | MARKFDPTISQEELYPPAEESRREEVHDARLLDLDV |
| Ga0210403_112766122 | 3300020580 | Soil | MARKSGSTIAQEELYPPPHEPVRPASEDALDDARLLDLDV |
| Ga0210401_102694012 | 3300020583 | Soil | MARKSGSTISQEELYPPSHEPARPVPDDALDDARMLDLDVEQESPFLRGQKR |
| Ga0210405_101930511 | 3300021171 | Soil | MARKSSPTILQEELYPPPGEPERELDNARLVDLDVEEES |
| Ga0210396_110095002 | 3300021180 | Soil | MARKSSPTISQEELYPLTDDAVREDLDDARLLDLDVEQESPFLRAQKRVS |
| Ga0210389_111780762 | 3300021404 | Soil | MARKGSSTISQEELYPAVHEPARPATDDTLDDARMLDLDVEQES |
| Ga0210389_114081551 | 3300021404 | Soil | MARKGGSTISQEELYPPAHEPARPAPDGALDDARMLDLDVEQESPFL |
| Ga0210384_109918812 | 3300021432 | Soil | MARKSPTISQDELYSQPEESVREEVDDPRALDLDVEQESPFLRGQKR |
| Ga0210398_106247232 | 3300021477 | Soil | MARKVSSTISQEELYPQADEPARQELDDAHRLDLD |
| Ga0210398_111101901 | 3300021477 | Soil | MARKGSSTISQEELYPAVHEPARPATDDTLDDARMLDLDVEQESP |
| Ga0212123_106853342 | 3300022557 | Iron-Sulfur Acid Spring | MARKGSSTISQEELYPAVHEPARPAPDDTLDDARMLDLDVEQES |
| Ga0242654_100832451 | 3300022726 | Soil | MARKSGSTISQEELYPPAHEPARPVPDDALDDARMLDLDAAQESPFLRGQK |
| Ga0208219_11256811 | 3300025625 | Arctic Peat Soil | MARKSGSTISQEELYPQPDEPVREEVDDPRLLDLD |
| Ga0207646_110192562 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MARKSPTITQDELYPPDEEFARQDIDDARLLDLDLE |
| Ga0207664_106399902 | 3300025929 | Agricultural Soil | MARKSSPTILQEELYPPPGEPERELDNARLVDLDVEEESPFLRG |
| Ga0209236_12389672 | 3300026298 | Grasslands Soil | MARKTGPTISQEECYPLADEPVREELDDARLLDLDVEQESPFLR |
| Ga0209468_11069541 | 3300026306 | Soil | MARKTPTISQEELYLQPDEPVREELDDARLLDLDAEE |
| Ga0209686_10063316 | 3300026315 | Soil | MARKTPTISQEESYLQPDEPVREELDDARLLDLDAEEESPFLRGQKRVSVRR |
| Ga0209472_11000393 | 3300026323 | Soil | MARKTPTISQEESYLQPDEPVREELDDARLLDLDAEE |
| Ga0209470_11574643 | 3300026324 | Soil | MARKSSPTISQDELYPPSEEFAREEIEDARLLDLDVEQESP |
| Ga0209158_13000162 | 3300026333 | Soil | MARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQES |
| Ga0209377_12324232 | 3300026334 | Soil | MARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESPFLRAQKRV |
| Ga0209059_11449651 | 3300026527 | Soil | MARKSPTITQDELYPPDEEFARQDIDDARLLDLDVEQESPFLRAQKRVSV |
| Ga0208827_10409963 | 3300027641 | Peatlands Soil | MARKSGSTISQEELYPPAHEPARPAPDDALDHARMLDLEVEQESP |
| Ga0209465_101613211 | 3300027874 | Tropical Forest Soil | MARKSSPTIVQEELYPPPGEPEREVLDDARLLDLDVEEESPFLR |
| Ga0209006_111020352 | 3300027908 | Forest Soil | MARKSGSTISQEELYPQADEPSRQELDDAHRLDLDVDEQSPFL |
| Ga0308309_102086321 | 3300028906 | Soil | MARKSGPTILQEELYPSSAEAAREEMDDARLLDLDVDEESPFLRGQKRVS |
| Ga0316363_103212122 | 3300030659 | Peatlands Soil | MARKSGSTILQEESYPPAHEPSRPVPDDGLDDACLLDLDVEQESPFLRGQKRVS |
| Ga0307469_112774801 | 3300031720 | Hardwood Forest Soil | MARKSGPTIEQEELYPPPDESGRGELDDARVLDLEVEQES |
| Ga0307468_1000507523 | 3300031740 | Hardwood Forest Soil | MARKSAPTISQEELYPESDEPTRQDLDDARLLDLDAEQESPFLR |
| Ga0307468_1024093531 | 3300031740 | Hardwood Forest Soil | MARKSGPTISQEELYPLADEPRREEVHDARLLELDVEQEPPFLRVQ |
| Ga0307473_110926592 | 3300031820 | Hardwood Forest Soil | MARKGSSTISQEELYPTSHEPVREELDDARTLDLDVDQESPFLRGQKRFS |
| Ga0307478_100500191 | 3300031823 | Hardwood Forest Soil | MARKSGSTISQEELYPPSEVRDEPLREEFDGARMIDLDAEQESP |
| Ga0306926_126998761 | 3300031954 | Soil | MARKSSPTILQEELYLAPEVSERESPDDARRFDLDVEEES |
| Ga0307471_1007034031 | 3300032180 | Hardwood Forest Soil | MARKTGPPISQEELYPVSDELPREDLDDARLLDLDVEQESPFLRAQ |
| Ga0307472_1007894331 | 3300032205 | Hardwood Forest Soil | MARKNGPTISQEELYPLADEPGREEGARLLDLDAEQE |
| Ga0335079_117862981 | 3300032783 | Soil | MARKASSTISQEELYPQADEPVREALDDARLLDLDVEEES |
| Ga0335078_105857753 | 3300032805 | Soil | MARKSGSTIVQEELYPQSDEPVGTPELDDARLVDLDVEQESPFLRGQ |
| Ga0335078_112592102 | 3300032805 | Soil | MARKASSTISQEELYPQMDEPAPEPLDDARLLDLDVEEES |
| Ga0335080_105975563 | 3300032828 | Soil | MARKASSTISQEELYPQADEAVRPEVDDARLLDLDV |
| Ga0335071_116148632 | 3300032897 | Soil | MARKSPTISQDELYSQPDEPVREERDDPRALDLDVEQESPFL |
| Ga0335077_106393772 | 3300033158 | Soil | MARKASSTISQEELYPRSDDDVRADLDDARPIDLDVEEESPFLRA |
| ⦗Top⦘ |