


| Basic Information | |
|---|---|
| Family ID | F101599 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MDQVLQIALESPLPTLHEEETAQPIAPLTSSTGDSPAAHQ |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.765 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (9.804 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.451 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.882 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.76% β-sheet: 0.00% Coil/Unstructured: 88.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF06559 | DCD | 44.12 |
| PF07238 | PilZ | 18.63 |
| PF01926 | MMR_HSR1 | 11.76 |
| PF12704 | MacB_PCD | 1.96 |
| PF01053 | Cys_Met_Meta_PP | 0.98 |
| PF01370 | Epimerase | 0.98 |
| PF03167 | UDG | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 44.12 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.98 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.98 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.98 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.98 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.98 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.98 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.98 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.98 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.98 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.98 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.98 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.76 % |
| All Organisms | root | All Organisms | 38.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001175|JGI12649J13570_1029595 | Not Available | 574 | Open in IMG/M |
| 3300004080|Ga0062385_10602668 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300004080|Ga0062385_10670508 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300004135|Ga0058884_1308595 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005542|Ga0070732_10487836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 746 | Open in IMG/M |
| 3300005554|Ga0066661_10081729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1905 | Open in IMG/M |
| 3300005577|Ga0068857_101698870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300005586|Ga0066691_10142732 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300005586|Ga0066691_10337072 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005591|Ga0070761_10128082 | Not Available | 1477 | Open in IMG/M |
| 3300006086|Ga0075019_10905938 | Not Available | 566 | Open in IMG/M |
| 3300006162|Ga0075030_100656839 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300006175|Ga0070712_101921492 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300007982|Ga0102924_1153513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1059 | Open in IMG/M |
| 3300007982|Ga0102924_1336023 | Not Available | 588 | Open in IMG/M |
| 3300009088|Ga0099830_11576220 | Not Available | 547 | Open in IMG/M |
| 3300009090|Ga0099827_10491560 | Not Available | 1054 | Open in IMG/M |
| 3300009143|Ga0099792_10811080 | Not Available | 614 | Open in IMG/M |
| 3300009523|Ga0116221_1208375 | Not Available | 847 | Open in IMG/M |
| 3300009624|Ga0116105_1005199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2681 | Open in IMG/M |
| 3300009672|Ga0116215_1125812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
| 3300009698|Ga0116216_10451784 | Not Available | 778 | Open in IMG/M |
| 3300009759|Ga0116101_1134712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300009824|Ga0116219_10241589 | Not Available | 1027 | Open in IMG/M |
| 3300010048|Ga0126373_11363675 | Not Available | 775 | Open in IMG/M |
| 3300010362|Ga0126377_11144195 | Not Available | 848 | Open in IMG/M |
| 3300010366|Ga0126379_12221051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300010398|Ga0126383_10267793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1687 | Open in IMG/M |
| 3300011271|Ga0137393_11339309 | Not Available | 605 | Open in IMG/M |
| 3300012096|Ga0137389_10857842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300012362|Ga0137361_10470965 | Not Available | 1154 | Open in IMG/M |
| 3300014201|Ga0181537_11158857 | Not Available | 522 | Open in IMG/M |
| 3300014501|Ga0182024_12845730 | Not Available | 514 | Open in IMG/M |
| 3300015374|Ga0132255_105767263 | Not Available | 524 | Open in IMG/M |
| 3300016294|Ga0182041_10192440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1617 | Open in IMG/M |
| 3300016422|Ga0182039_10883242 | Not Available | 797 | Open in IMG/M |
| 3300017822|Ga0187802_10296140 | Not Available | 630 | Open in IMG/M |
| 3300017823|Ga0187818_10019090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2934 | Open in IMG/M |
| 3300017972|Ga0187781_10672492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300017972|Ga0187781_10887649 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300017973|Ga0187780_11004988 | Not Available | 608 | Open in IMG/M |
| 3300017975|Ga0187782_10028969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4027 | Open in IMG/M |
| 3300017975|Ga0187782_10136072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1823 | Open in IMG/M |
| 3300018007|Ga0187805_10557419 | Not Available | 540 | Open in IMG/M |
| 3300018034|Ga0187863_10080967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1828 | Open in IMG/M |
| 3300018042|Ga0187871_10608621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300018085|Ga0187772_10515291 | Not Available | 844 | Open in IMG/M |
| 3300018088|Ga0187771_10180809 | Not Available | 1744 | Open in IMG/M |
| 3300018088|Ga0187771_11606009 | Not Available | 552 | Open in IMG/M |
| 3300018088|Ga0187771_11698276 | Not Available | 536 | Open in IMG/M |
| 3300018090|Ga0187770_11276446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 595 | Open in IMG/M |
| 3300019270|Ga0181512_1058746 | Not Available | 591 | Open in IMG/M |
| 3300020583|Ga0210401_10833740 | Not Available | 781 | Open in IMG/M |
| 3300021402|Ga0210385_10185174 | Not Available | 1508 | Open in IMG/M |
| 3300021402|Ga0210385_11120641 | Not Available | 604 | Open in IMG/M |
| 3300021420|Ga0210394_11510862 | Not Available | 568 | Open in IMG/M |
| 3300021478|Ga0210402_10738245 | Not Available | 909 | Open in IMG/M |
| 3300021559|Ga0210409_11331941 | Not Available | 594 | Open in IMG/M |
| 3300021560|Ga0126371_10694805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1165 | Open in IMG/M |
| 3300021560|Ga0126371_10695428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
| 3300021861|Ga0213853_10156595 | Not Available | 731 | Open in IMG/M |
| 3300022525|Ga0242656_1139070 | Not Available | 505 | Open in IMG/M |
| 3300024225|Ga0224572_1042573 | Not Available | 854 | Open in IMG/M |
| 3300024347|Ga0179591_1139676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3022 | Open in IMG/M |
| 3300025463|Ga0208193_1014057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2351 | Open in IMG/M |
| 3300025612|Ga0208691_1064472 | Not Available | 828 | Open in IMG/M |
| 3300025945|Ga0207679_10864845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300026514|Ga0257168_1022785 | Not Available | 1305 | Open in IMG/M |
| 3300026557|Ga0179587_10823860 | Not Available | 612 | Open in IMG/M |
| 3300027080|Ga0208237_1060694 | Not Available | 559 | Open in IMG/M |
| 3300027497|Ga0208199_1023935 | Not Available | 1356 | Open in IMG/M |
| 3300027625|Ga0208044_1142298 | Not Available | 670 | Open in IMG/M |
| 3300027853|Ga0209274_10285017 | Not Available | 848 | Open in IMG/M |
| 3300027854|Ga0209517_10493045 | Not Available | 669 | Open in IMG/M |
| 3300027889|Ga0209380_10280798 | Not Available | 978 | Open in IMG/M |
| 3300027915|Ga0209069_10256424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300028536|Ga0137415_11391513 | Not Available | 523 | Open in IMG/M |
| 3300028731|Ga0302301_1081089 | Not Available | 847 | Open in IMG/M |
| 3300028776|Ga0302303_10100975 | Not Available | 1057 | Open in IMG/M |
| 3300028800|Ga0265338_11059710 | Not Available | 547 | Open in IMG/M |
| 3300028871|Ga0302230_10057340 | Not Available | 1630 | Open in IMG/M |
| 3300029882|Ga0311368_10952179 | Not Available | 571 | Open in IMG/M |
| 3300029915|Ga0311358_10377952 | Not Available | 1157 | Open in IMG/M |
| 3300029943|Ga0311340_10783558 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300029993|Ga0302304_10222450 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300030007|Ga0311338_11033624 | Not Available | 794 | Open in IMG/M |
| 3300030740|Ga0265460_11969672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300031234|Ga0302325_11517685 | Not Available | 861 | Open in IMG/M |
| 3300031234|Ga0302325_11861988 | Not Available | 750 | Open in IMG/M |
| 3300031261|Ga0302140_11059697 | Not Available | 553 | Open in IMG/M |
| 3300031573|Ga0310915_11035699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300031708|Ga0310686_101377752 | Not Available | 569 | Open in IMG/M |
| 3300031708|Ga0310686_107135701 | Not Available | 567 | Open in IMG/M |
| 3300031708|Ga0310686_109504508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2703 | Open in IMG/M |
| 3300031954|Ga0306926_10469271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1549 | Open in IMG/M |
| 3300032160|Ga0311301_11602874 | Not Available | 792 | Open in IMG/M |
| 3300032174|Ga0307470_10076373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1830 | Open in IMG/M |
| 3300032174|Ga0307470_10090611 | Not Available | 1719 | Open in IMG/M |
| 3300032897|Ga0335071_10879540 | Not Available | 844 | Open in IMG/M |
| 3300032954|Ga0335083_11347543 | Not Available | 547 | Open in IMG/M |
| 3300034163|Ga0370515_0468989 | Not Available | 531 | Open in IMG/M |
| 3300034199|Ga0370514_079748 | Not Available | 831 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 9.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12649J13570_10295951 | 3300001175 | Forest Soil | QVLQIALESPLPALREEETTQPIAPLTSATEDSPATHQ* |
| Ga0062385_106026682 | 3300004080 | Bog Forest Soil | MHFVDTMDQVLQIALESPLPSFREEETSQPIAPLTSNTGDSPAAHQ* |
| Ga0062385_106705082 | 3300004080 | Bog Forest Soil | MHFVDTMDQVLQIALESPLPSFREEETTQPIAPLTSSTGDSPAAHQ* |
| Ga0058884_13085951 | 3300004135 | Forest Soil | LHFVDTMDQVLQIALVSPLPSLSEDVTTQPIAPLTSSTDDSPAAHQ* |
| Ga0070732_104878362 | 3300005542 | Surface Soil | VDTMDQVLSIALESPLPKFEEETTTQPIAPLTTTTPESPTAHQ* |
| Ga0066661_100817291 | 3300005554 | Soil | VDTMDQVLQIALEGPLPTIEEEVTRPIAPPLTSTTSDSPTAHQ* |
| Ga0068857_1016988701 | 3300005577 | Corn Rhizosphere | QVLQIALESPLPKMAEEVTEPIAPPLTTGNSDAPTAHQ* |
| Ga0066691_101427321 | 3300005586 | Soil | LHFVDTMDQVLQIALESPLPTLDEVVTQPIAPLTSGTEQSPTTHQ* |
| Ga0066691_103370721 | 3300005586 | Soil | DTMDQVLQIALEGPLPKLEDEAARTIAPLTSTTGDSPTAHQ* |
| Ga0070761_101280822 | 3300005591 | Soil | QIALESALPSLSEEEAAHPIAPLTDVPEDSPAARQ* |
| Ga0075019_109059381 | 3300006086 | Watersheds | TMDQVLQIALEAPLPKIEEEGTQPIAPPLTSTTSDSPTAHQ* |
| Ga0075030_1006568392 | 3300006162 | Watersheds | VDTMDQVLQIALEGPLPKIEEEVTQPIAPPLTSTTSDSPTAHQ* |
| Ga0070712_1019214921 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DTMDQVLQIALESPLPKLDEEPTQPIAPLTTGTPDAPTAHQ* |
| Ga0102924_11535131 | 3300007982 | Iron-Sulfur Acid Spring | AMKMHFVDTMDQVLQIALESPLQSISEEETTRPIAPLTSNTGDSPAAHQ* |
| Ga0102924_13360231 | 3300007982 | Iron-Sulfur Acid Spring | KLHFVDTMDQVLQIALESPLPSLDAEIERPIAPLTTGSPEAPTAHQ* |
| Ga0099830_115762201 | 3300009088 | Vadose Zone Soil | LHFVDTMDQVLQIALESPLPAFSEDVTAQPIAPLTSTTNESPATHQ* |
| Ga0099827_104915602 | 3300009090 | Vadose Zone Soil | DTMDQVLQIALESPLPTLSEDVTAQPIAPLTSGAEESPATHQ* |
| Ga0099792_108110801 | 3300009143 | Vadose Zone Soil | VLQIALESPLPTLEDEAARPIAPLTSTTGDSPAAHQ* |
| Ga0116221_12083753 | 3300009523 | Peatlands Soil | TMDQVLQIALEAPLPASVEETAQPLAPPLTTGSAEAPTAHQ* |
| Ga0116105_10051991 | 3300009624 | Peatland | MDQVLAIALESPLPKLDEEVVQPIAPPLTSDSTDAPTAHQ* |
| Ga0116215_11258121 | 3300009672 | Peatlands Soil | QVLQIALESPLPASEPDAQPIAPPLTTVATDAPTAHQ* |
| Ga0116216_104517841 | 3300009698 | Peatlands Soil | HFVDTMDQVLQIALESAPPKIDEEGTQPIAPPLTSSTTDATTAHQ* |
| Ga0116101_11347122 | 3300009759 | Peatland | FVDTMDQVLQIALESPLPVRSDDETQPIAPPPLTSSTGDTPTAHQ* |
| Ga0116219_102415892 | 3300009824 | Peatlands Soil | VDTMDQVLQIALESPLPTLSEDEATRPIAPLTSSTGDSPAAHQ* |
| Ga0126373_113636751 | 3300010048 | Tropical Forest Soil | IALESPLPKIEEEATQAIAPPLTSTTPESPTAHQ* |
| Ga0126377_111441953 | 3300010362 | Tropical Forest Soil | AIALESPLPKIEEEATQAIAPPLTSTTPESPTAHQ* |
| Ga0126379_122210511 | 3300010366 | Tropical Forest Soil | FKLHFVDTMDQVLQIALESPLPKLEEGVVTQPIAPPLTSTTVEAPATHQ* |
| Ga0126383_102677931 | 3300010398 | Tropical Forest Soil | MDQVLQIALEAPLPTVVDEVTQPIAPALTSTIPESPTAHQ* |
| Ga0137393_113393091 | 3300011271 | Vadose Zone Soil | DTMDQVLQIALESPLPTLEDEAARPIAPLTSTTGDSPAAHQ* |
| Ga0137389_108578421 | 3300012096 | Vadose Zone Soil | QVLQVALESPLPKMEETVPQPIAPMTSDTGESPATHQ* |
| Ga0137361_104709651 | 3300012362 | Vadose Zone Soil | MKMHFVDTMDQVLQIALESALPSLGEDVTAQPIAPLTSSTTDTPAAHQ* |
| Ga0181537_111588571 | 3300014201 | Bog | IALETALPALSEDVPTQPIAPLTSETGDSPAAHQ* |
| Ga0182024_128457301 | 3300014501 | Permafrost | TMDQVLQIALEGPLPKMEEEVAQQIAPLTSTPTEGPATHQ* |
| Ga0132255_1057672632 | 3300015374 | Arabidopsis Rhizosphere | VLQIALEGPLPKIEEEVTQPIAPPLTSTTADSPTAHQ* |
| Ga0182041_101924401 | 3300016294 | Soil | QVLQIALEAPLPKMIEEEVAQPIAPALTSSTPESPTAHQ |
| Ga0182039_108832423 | 3300016422 | Soil | QIALEGPLPKIVEEVTQPIAPALTSTTSDSPTAHQ |
| Ga0187802_102961401 | 3300017822 | Freshwater Sediment | RNSMKLHFVDTMDQVLQLALESAPPQIEELASQPIAPPLTSRTTEAPTAHQ |
| Ga0187818_100190901 | 3300017823 | Freshwater Sediment | TMDQVLQIALEAPLPKIEEEVTQPIAPQLTSTTPDSPTAHQ |
| Ga0187781_106724921 | 3300017972 | Tropical Peatland | FVDTMDQVLQLALESPLPKATEEITQAIAPPLTATTSDSPTAHQ |
| Ga0187781_108876491 | 3300017972 | Tropical Peatland | AMKMHFVDTMDQVLQIALVSPLPTLQEEDTAQPIAPLTSSTGDSPAAHQ |
| Ga0187780_110049882 | 3300017973 | Tropical Peatland | FVDTMDQVLAIALESPLPKIEEEGTHPIAPPLTATTEAPTAHQ |
| Ga0187782_100289691 | 3300017975 | Tropical Peatland | QIALESALPQIVEDATQPIAPPLTTGTGDVPTAHQ |
| Ga0187782_101360721 | 3300017975 | Tropical Peatland | HFVDTMDQVLAIALESPLPKIEEEGTQPIAPPLTTGTAEAPTAHQ |
| Ga0187805_105574191 | 3300018007 | Freshwater Sediment | MKLHFVDTMDQVLQIALESAPPQIEELGSQPIAPPLSPATEGPAAHQ |
| Ga0187863_100809673 | 3300018034 | Peatland | HFVDTMDQVLQIALESPLPKLDEEPTQPIAPLTTGSTDAPTAHQ |
| Ga0187871_106086212 | 3300018042 | Peatland | MKMHFVDTMDQVLQIALESPLQSISEDDTSRPIAPLTSGPGDSPTAHQ |
| Ga0187772_105152912 | 3300018085 | Tropical Peatland | VLQIALEGPLPASVEETAQPLAPPLTTTTEAPAAHQ |
| Ga0187771_101808093 | 3300018088 | Tropical Peatland | FVDTMDQVLQIALEAPLPARVEETAQPLAPPLTASTPEAPTAHQ |
| Ga0187771_116060091 | 3300018088 | Tropical Peatland | DTMDQVLQIALEGPLPSLSEDVTAQPIAPPPLTSGTGDSPTAHQ |
| Ga0187771_116982762 | 3300018088 | Tropical Peatland | LHFVDTMDQVLAIAFESPLPKIEEEGTHPIAPPLTATTEAPTAHQ |
| Ga0187770_112764462 | 3300018090 | Tropical Peatland | FVDTMDQVLQIALESPLPKIVEEETTQAIAPPLTTSTTDAPAAHQ |
| Ga0181512_10587461 | 3300019270 | Peatland | LHFVDTMDQVLQIALESPLPKIDAEVAQAIAPLTSDTVGSPAAHQ |
| Ga0210401_108337402 | 3300020583 | Soil | HFVDTMDQVLQIALESPLQAINEDVTAQPIAPLTSVEESPATHQ |
| Ga0210385_101851743 | 3300021402 | Soil | LQIALVSPLPTMSDEETTQPITPPLTSSTGESPATHQ |
| Ga0210385_111206412 | 3300021402 | Soil | LHFVDTMDQVLQIALESALPTLGEDVTTQPIAPLTSSTGDSPAAHQ |
| Ga0210394_115108622 | 3300021420 | Soil | QVLQIALESPLPSISEDVSSQPIAPLTSSTEDSPAAHQ |
| Ga0210402_107382451 | 3300021478 | Soil | LQIALESPLPKIEEEATQPIAPPLTTGTGDSPTAHQ |
| Ga0210409_113319412 | 3300021559 | Soil | NSMKMHFVDTMDQVLQIALESPLQAINEDVTAQPIAALTSVEESPATHQ |
| Ga0126371_106948053 | 3300021560 | Tropical Forest Soil | QVLQIALEAPLPTVVDEVTQPIAPALTSTTPESPTAHQ |
| Ga0126371_106954281 | 3300021560 | Tropical Forest Soil | MDQVLAIALESPLPKIEEAETTAQPIAPPPLTATTPETPTAHQ |
| Ga0213853_101565952 | 3300021861 | Watersheds | DTMDQVLQLALESAPPKIDEEGTQPIAPPLTSGTAVAPTAHQ |
| Ga0242656_11390701 | 3300022525 | Soil | HFVDTMDQVLQIALVSPLPSLSEDVTTQPIAPLTSSTEDGPTAHQ |
| Ga0224572_10425732 | 3300024225 | Rhizosphere | MDQVLQIALESPLPSISEDVSSQPIAPLTSSTGDSPAAHQ |
| Ga0179591_11396762 | 3300024347 | Vadose Zone Soil | MKMHFVDTMDQVLQIALESPLPALAEDVTAQPIAPLTSGPEESPATHQ |
| Ga0208193_10140571 | 3300025463 | Peatland | DQVLQIALESPLPALREEETTQPIAPLTSATEDSPATHQ |
| Ga0208691_10644722 | 3300025612 | Peatland | VLQIALESALPSLSEEEATHPIAPLTDVPEDSPAARQ |
| Ga0207679_108648453 | 3300025945 | Corn Rhizosphere | VLQIALESPLPKMAEEVTEPIAPPLTTGNSDAPTAHQ |
| Ga0257168_10227852 | 3300026514 | Soil | HFVDTMDQVLQIALESPLPTLEDEAARPIAPLTSSTGDSPAAHQ |
| Ga0179587_108238603 | 3300026557 | Vadose Zone Soil | VLAIALESPLPALGAVETTQPIAPLTSGTADSPAAHQ |
| Ga0208237_10606942 | 3300027080 | Forest Soil | MDQVLQIALESPLPSLHEEETSQPIAPLTSGTGDSPAAHQ |
| Ga0208199_10239352 | 3300027497 | Peatlands Soil | QIALESPLPAFHQEDTTQPIAPLTSNTGDSPTAHQ |
| Ga0208044_11422981 | 3300027625 | Peatlands Soil | VDTMDQVLAIALESPLPPFHEEETAQPIAPLTSNTGDSPAAHQ |
| Ga0209274_102850172 | 3300027853 | Soil | DQVLQIALESALPSLSEEEAAHPIAPLTDVPEDSPAARQ |
| Ga0209517_104930451 | 3300027854 | Peatlands Soil | DTMDQVLQIALESPLPTLSEDEATRPIAPLTSSTGDSPAAHQ |
| Ga0209380_102807981 | 3300027889 | Soil | QVLQIALVSPLPSIGEDVTTQPIAPLTASTDDSPAAHQ |
| Ga0209069_102564241 | 3300027915 | Watersheds | DTMDQVLQIALVSPLPTLSEDETTQPIAPLTSSTGDSPATHQ |
| Ga0137415_113915131 | 3300028536 | Vadose Zone Soil | LQIALEGPLPKLEDETARPIAPLTSSTGDSPTAHQ |
| Ga0302301_10810892 | 3300028731 | Palsa | DTMDQVLQIALESPLPLIGEDITAQPIAPLTSETGDSPAAHQ |
| Ga0302303_101009751 | 3300028776 | Palsa | HFVDTMDQVLQIALESPLPLIGEDITAQPIAPLTSETGDSPAAHQ |
| Ga0265338_110597101 | 3300028800 | Rhizosphere | TMDQVLQIALEGPLPKMEEEVAQQIAPLTSTTTESPATHQ |
| Ga0302230_100573402 | 3300028871 | Palsa | DTMDQVLQIALESPLPTFHEEETTQPIAPLTSSTGDGPAAHQ |
| Ga0311368_109521791 | 3300029882 | Palsa | DTMDQVLQIALESALPTLGEDVTTQPIAPLTSSTGDSPAAHQ |
| Ga0311358_103779522 | 3300029915 | Bog | VLQIALESPLPAMTEEESAHPIAPPLTSGAGESPATHQ |
| Ga0311340_107835582 | 3300029943 | Palsa | NAMKLHFVDTMDQVLQIALESALPALSEDVTTQPIAPLTSGTGDSPAAHQ |
| Ga0302304_102224502 | 3300029993 | Palsa | AMKMHFVDTMDQVLQIALESPLPLIGEDITAQPIAPLTSETGDSPAAHQ |
| Ga0311338_110336242 | 3300030007 | Palsa | MDQVLQIALESPLPTLHEEETAQPIAPLTSSTGDSPAAHQ |
| Ga0265460_119696722 | 3300030740 | Soil | FVDTMDQVLQIAVESPLPSILEEETAQPIAPLTSSTGDSPAAHQ |
| Ga0302325_115176851 | 3300031234 | Palsa | AMKLHFVDTMDQVLQIALESALPVLRDEETPIAREDEAAQPIAPLTSSTGDGPAAHQ |
| Ga0302325_118619881 | 3300031234 | Palsa | DQVLQIALESPLPKIDAEVAQTIAPLTSDSVGSPAAHQ |
| Ga0302140_110596972 | 3300031261 | Bog | TMDQVLQIALESPLPAMTEEESAHPIAPPLTSGAGESPATHQ |
| Ga0310915_110356991 | 3300031573 | Soil | DTMDQVLQIALEAPLPKMIEEEVAQPIAPALTSSTPESPTAHQ |
| Ga0310686_1013777521 | 3300031708 | Soil | DQVLQIALESPLPALNEDVIAQPIAPPLTSGADESSTTHQ |
| Ga0310686_1071357011 | 3300031708 | Soil | VLQIALESPLPSIGEDITAQPIAPLTSGAEDSPAAHQ |
| Ga0310686_1095045081 | 3300031708 | Soil | FVDTMDQVLQIALESPLPTFHAEETTQPIAPLTSNPGDSPTAHQ |
| Ga0306926_104692711 | 3300031954 | Soil | FVDTMDQVLQIALEAPLPKMIEEEVAQPIAPALTSSTPESPTAHQ |
| Ga0311301_116028742 | 3300032160 | Peatlands Soil | YQVLQLALEGPLPKVVEEGTQPIAPLTSSTSDTPTAHQ |
| Ga0307470_100763731 | 3300032174 | Hardwood Forest Soil | VDTMDQVLQIALEGPLPTIEEEVTRPIAPPLTSTTSDSPTAHQ |
| Ga0307470_100906111 | 3300032174 | Hardwood Forest Soil | NAMKLHFVDTMDQVLAIALESPLPTFTEDVTAQPIAPLTSTTTESPATHQ |
| Ga0335071_108795401 | 3300032897 | Soil | LAIALESPLPKVEEEVTAQPIAPPLTSTTTDTTTAHQ |
| Ga0335083_113475431 | 3300032954 | Soil | DTMDQVLQIALEAPLSAIEEATTQPIAPLTTSTPEGTTAHQ |
| Ga0370515_0468989_408_530 | 3300034163 | Untreated Peat Soil | MDQVLQIALESPLPSIGEDITAQPIAPLTSGAEDSPATHQ |
| Ga0370514_079748_694_816 | 3300034199 | Untreated Peat Soil | MDQVLQIALESPLPSIGEDITAQPIAPLTSETGDSPAAHQ |
| ⦗Top⦘ |