


| Basic Information | |
|---|---|
| Family ID | F101588 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSEIEKQTEPIASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.35 % |
| % of genes near scaffold ends (potentially truncated) | 25.49 % |
| % of genes from short scaffolds (< 2000 bps) | 78.43 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.549 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.216 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.039 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13533 | Biotin_lipoyl_2 | 31.37 |
| PF16576 | HlyD_D23 | 13.73 |
| PF00529 | CusB_dom_1 | 5.88 |
| PF12700 | HlyD_2 | 1.96 |
| PF07690 | MFS_1 | 1.96 |
| PF08281 | Sigma70_r4_2 | 1.96 |
| PF01040 | UbiA | 0.98 |
| PF02776 | TPP_enzyme_N | 0.98 |
| PF10431 | ClpB_D2-small | 0.98 |
| PF02405 | MlaE | 0.98 |
| PF03886 | ABC_trans_aux | 0.98 |
| PF12710 | HAD | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.55 % |
| Unclassified | root | N/A | 27.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_12992481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1730 | Open in IMG/M |
| 3300001471|JGI12712J15308_10203321 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300001867|JGI12627J18819_10234102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
| 3300002907|JGI25613J43889_10117574 | Not Available | 675 | Open in IMG/M |
| 3300002910|JGI25615J43890_1006610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1800 | Open in IMG/M |
| 3300002914|JGI25617J43924_10031871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1878 | Open in IMG/M |
| 3300002917|JGI25616J43925_10206668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300004479|Ga0062595_101397877 | Not Available | 638 | Open in IMG/M |
| 3300005166|Ga0066674_10155140 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005180|Ga0066685_10128930 | Not Available | 1709 | Open in IMG/M |
| 3300005180|Ga0066685_11052527 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005187|Ga0066675_10503702 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005356|Ga0070674_101447463 | Not Available | 616 | Open in IMG/M |
| 3300005365|Ga0070688_100309676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1144 | Open in IMG/M |
| 3300005436|Ga0070713_100943097 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005445|Ga0070708_100142951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2220 | Open in IMG/M |
| 3300005451|Ga0066681_10491814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300005518|Ga0070699_101663419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300005549|Ga0070704_100133160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1930 | Open in IMG/M |
| 3300005554|Ga0066661_10113857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1629 | Open in IMG/M |
| 3300005718|Ga0068866_10232885 | Not Available | 1118 | Open in IMG/M |
| 3300006047|Ga0075024_100641050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300006176|Ga0070765_100042520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3649 | Open in IMG/M |
| 3300006796|Ga0066665_10606391 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300006797|Ga0066659_11173507 | Not Available | 642 | Open in IMG/M |
| 3300006854|Ga0075425_103119291 | Not Available | 505 | Open in IMG/M |
| 3300007076|Ga0075435_101111107 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300007255|Ga0099791_10688824 | Not Available | 502 | Open in IMG/M |
| 3300007258|Ga0099793_10380912 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300009012|Ga0066710_103010424 | Not Available | 656 | Open in IMG/M |
| 3300009038|Ga0099829_11604703 | Not Available | 537 | Open in IMG/M |
| 3300009088|Ga0099830_10105024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2114 | Open in IMG/M |
| 3300009088|Ga0099830_10301580 | Not Available | 1279 | Open in IMG/M |
| 3300009089|Ga0099828_10183313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
| 3300009090|Ga0099827_10484062 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300009176|Ga0105242_10373951 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300010303|Ga0134082_10478358 | Not Available | 541 | Open in IMG/M |
| 3300011269|Ga0137392_10068823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2718 | Open in IMG/M |
| 3300011271|Ga0137393_11119760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300012198|Ga0137364_10059230 | Not Available | 2581 | Open in IMG/M |
| 3300012199|Ga0137383_10496758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300012200|Ga0137382_10489187 | Not Available | 873 | Open in IMG/M |
| 3300012201|Ga0137365_10010294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7400 | Open in IMG/M |
| 3300012202|Ga0137363_10036580 | All Organisms → cellular organisms → Bacteria | 3432 | Open in IMG/M |
| 3300012202|Ga0137363_10208500 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300012206|Ga0137380_11606615 | Not Available | 534 | Open in IMG/M |
| 3300012210|Ga0137378_11168339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300012210|Ga0137378_11532231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300012351|Ga0137386_10258046 | Not Available | 1253 | Open in IMG/M |
| 3300012363|Ga0137390_10782259 | Not Available | 913 | Open in IMG/M |
| 3300012685|Ga0137397_10925644 | Not Available | 645 | Open in IMG/M |
| 3300012917|Ga0137395_10087185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2050 | Open in IMG/M |
| 3300012917|Ga0137395_10422511 | Not Available | 956 | Open in IMG/M |
| 3300012922|Ga0137394_11588895 | Not Available | 511 | Open in IMG/M |
| 3300012925|Ga0137419_11392757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012929|Ga0137404_10209888 | Not Available | 1654 | Open in IMG/M |
| 3300013306|Ga0163162_11945715 | Not Available | 673 | Open in IMG/M |
| 3300015053|Ga0137405_1410275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1893 | Open in IMG/M |
| 3300015054|Ga0137420_1101796 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300015245|Ga0137409_10363345 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300018468|Ga0066662_10699510 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300018482|Ga0066669_11027089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300019789|Ga0137408_1210113 | Not Available | 623 | Open in IMG/M |
| 3300019887|Ga0193729_1018964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2999 | Open in IMG/M |
| 3300020199|Ga0179592_10024256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2714 | Open in IMG/M |
| 3300020579|Ga0210407_10002885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14333 | Open in IMG/M |
| 3300020579|Ga0210407_10368780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1123 | Open in IMG/M |
| 3300020580|Ga0210403_10018579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5554 | Open in IMG/M |
| 3300020580|Ga0210403_10053866 | All Organisms → cellular organisms → Bacteria | 3219 | Open in IMG/M |
| 3300020580|Ga0210403_10204914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1619 | Open in IMG/M |
| 3300021088|Ga0210404_10112989 | Not Available | 1386 | Open in IMG/M |
| 3300021170|Ga0210400_10681801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300021170|Ga0210400_10894725 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300021181|Ga0210388_10818892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300021404|Ga0210389_10813445 | Not Available | 730 | Open in IMG/M |
| 3300021406|Ga0210386_11380362 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300021407|Ga0210383_10149558 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300021420|Ga0210394_11149086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 668 | Open in IMG/M |
| 3300021479|Ga0210410_10011137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7750 | Open in IMG/M |
| 3300024330|Ga0137417_1120824 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300024330|Ga0137417_1357775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4171 | Open in IMG/M |
| 3300025899|Ga0207642_10234178 | Not Available | 1033 | Open in IMG/M |
| 3300026285|Ga0209438_1036961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1618 | Open in IMG/M |
| 3300026326|Ga0209801_1203829 | Not Available | 789 | Open in IMG/M |
| 3300026354|Ga0257180_1014185 | Not Available | 987 | Open in IMG/M |
| 3300026358|Ga0257166_1007045 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300026469|Ga0257169_1004271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1541 | Open in IMG/M |
| 3300026480|Ga0257177_1012976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1124 | Open in IMG/M |
| 3300026515|Ga0257158_1044536 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300026538|Ga0209056_10000183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 67294 | Open in IMG/M |
| 3300026551|Ga0209648_10011973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 7540 | Open in IMG/M |
| 3300026551|Ga0209648_10014353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6919 | Open in IMG/M |
| 3300026551|Ga0209648_10029685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4778 | Open in IMG/M |
| 3300026555|Ga0179593_1055248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2227 | Open in IMG/M |
| 3300027591|Ga0209733_1032548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300027645|Ga0209117_1002349 | All Organisms → cellular organisms → Bacteria | 6584 | Open in IMG/M |
| 3300027875|Ga0209283_10516140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300027903|Ga0209488_10994122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300031820|Ga0307473_10861817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300032174|Ga0307470_10004145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5592 | Open in IMG/M |
| 3300032205|Ga0307472_100467019 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300032205|Ga0307472_101330990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0495.00003910 | 2162886013 | Switchgrass Rhizosphere | MSAIEKQTAPIASARTSFDKQTGLSNSVTNSAAFADFSLLKEQI |
| JGI12712J15308_102033212 | 3300001471 | Forest Soil | MSAIKKQTEPIASEWTIFNKHRSLSNSARNRAAFADFMLPKEQI |
| JGI12627J18819_102341022 | 3300001867 | Forest Soil | MSECKKQTESIASAWMSFDKQWGLSNSVTNSAVSADFSLLKEQH* |
| JGI25613J43889_101175741 | 3300002907 | Grasslands Soil | MSEIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI* |
| JGI25615J43890_10066102 | 3300002910 | Grasslands Soil | MSEIEKXTEPVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI* |
| JGI25617J43924_100318711 | 3300002914 | Grasslands Soil | MSEIEKQTEPIASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI* |
| JGI25616J43925_102066681 | 3300002917 | Grasslands Soil | MSAIEKQTAPIASAWMSFDKQKGLSNSVTNSAAFADFLLLKEQI* |
| Ga0062595_1013978772 | 3300004479 | Soil | MSEIEKQAQPIASARMIFDKQRGASNPVTNIAFADLLLLKEQL* |
| Ga0066674_101551402 | 3300005166 | Soil | MSEIEKQTEPIASAWMSFDKQRGLSTSVTNSAAFADFLLLKEQI* |
| Ga0066685_101289303 | 3300005180 | Soil | MSAIEKETEPSASAWKIFDRQRGLSNSVMNSAAFADFLLLKEQI* |
| Ga0066685_110525272 | 3300005180 | Soil | MSEIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLLLKGKFDVRL |
| Ga0066675_105037022 | 3300005187 | Soil | MSVIEKETEPSASAWKIFDRQRGLSNSVMNSAAFADFLLLKEQI* |
| Ga0070674_1014474632 | 3300005356 | Miscanthus Rhizosphere | MSEIEKQAQPIASARMIFDKQRGASNPVTNIAFADFLLLKEQL* |
| Ga0070688_1003096762 | 3300005365 | Switchgrass Rhizosphere | MSAVEKQTAPIASARTSFDKQTGLSNSVTNSAAFADFSLLKEQI* |
| Ga0070713_1009430972 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIEKETEPIASVRKIFDRQRGLSNSVMNSAAFADFLLLKEHI* |
| Ga0070708_1001429513 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIEKQTAPIASAWMSFDRQKGLSNSVTNCAAFADFFLLKEQI* |
| Ga0066681_104918142 | 3300005451 | Soil | MSEIEKQTEPVPSAWMSFDKQRGLSTSVTNSAAFADFLLLKEQI* |
| Ga0070699_1016634192 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEIEKQTEPIASAWMSFDKQRGLSNLVTNSAAFADFLLLKEQI* |
| Ga0070704_1001331602 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIEKQTAPIASARTSFDKQTGLSNSVTNSAAFADFSLLKEQI* |
| Ga0066661_101138573 | 3300005554 | Soil | SKIEKQTEPIASAWMSFDKQRGLSTSVANSAAFADFLLLKEQI* |
| Ga0068866_102328851 | 3300005718 | Miscanthus Rhizosphere | SLRGVMSEIEKQAQPIASARMIFDKQRGASNPVTNIAFADLLLLKEQL* |
| Ga0075024_1006410502 | 3300006047 | Watersheds | MSEIEKQTEPIASAWMTFDKQRGLSKSVTNSASFADFLLLKEQI* |
| Ga0070765_1000425202 | 3300006176 | Soil | MSAIKKQTEPIASEWTIFNKHRSLSNSARNRAAFADFMLPKEQI* |
| Ga0066665_106063912 | 3300006796 | Soil | MSKIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFSLLKEQI* |
| Ga0066659_111735071 | 3300006797 | Soil | SVMSEIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI* |
| Ga0075425_1031192912 | 3300006854 | Populus Rhizosphere | LRGVMSAIEKQTAPIASAWMSFDKQTGLSTSVTNSVAFADFLLLKEQI* |
| Ga0075435_1011111072 | 3300007076 | Populus Rhizosphere | MSETEKQTEPIASAWMSFKQRGLSNSTTNSVAFTDFLLQKGKFN |
| Ga0099791_106888242 | 3300007255 | Vadose Zone Soil | MSEIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLMLKEQI* |
| Ga0099793_103809122 | 3300007258 | Vadose Zone Soil | MSAIKKQTESIASAWMTFNKQMSLSNSVTNSAAFADFLLLKEQI* |
| Ga0066710_1030104242 | 3300009012 | Grasslands Soil | AEPIASAWMSFDKQRGLSTSVTNSAAFADFLLLKEQI |
| Ga0099829_116047032 | 3300009038 | Vadose Zone Soil | MSAIEKQTAPIASAWMSFDKQKGLSNSKTNSAGFADFLLLKEQI* |
| Ga0099830_101050243 | 3300009088 | Vadose Zone Soil | MSAIKKQTEPIASAWMIFNRLMSLSNSVTNSAAFADFLLLKEQI* |
| Ga0099830_103015802 | 3300009088 | Vadose Zone Soil | MSEIEKQTELVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI* |
| Ga0099828_101833132 | 3300009089 | Vadose Zone Soil | MSAIKKQTEPIASAWMIFNKQRSLGNSVTNSAAFADFLLLKEQI* |
| Ga0099827_104840622 | 3300009090 | Vadose Zone Soil | MPEIEKRTEPIASAWMSFDKQKGLSNSITNSAAFADFLLLKEQI* |
| Ga0105242_103739513 | 3300009176 | Miscanthus Rhizosphere | VMSAIEKQTAPIASARTSFDKQTGLSNSVTNSAAFADFSLLKEQI* |
| Ga0134082_104783581 | 3300010303 | Grasslands Soil | VASAWMSVDKQRGLSNSVTNSAAFADFLLLKEQI* |
| Ga0137392_100688233 | 3300011269 | Vadose Zone Soil | VSAIKKQTEPIASAWMIFNKQKSLSNSVTNIAAFADFLLLKEQI* |
| Ga0137393_111197602 | 3300011271 | Vadose Zone Soil | MFSLRSVMPEIEKRTEPIASVWSFAKQKGLSNSITNSAAFADFLLLKEQI* |
| Ga0137364_100592305 | 3300012198 | Vadose Zone Soil | MSAIEKETEPSASAWKIFDRQRGLSNSVMNSAAFADFLPLKEQI* |
| Ga0137383_104967582 | 3300012199 | Vadose Zone Soil | MSAIKKQTEPIASAWMTFNKQMSLSNSVTNSAAFADFLPLKEQI* |
| Ga0137382_104891871 | 3300012200 | Vadose Zone Soil | EKETEPSASAWKIFDRQRGLSNSVMNSAAFADFLPLKEQI* |
| Ga0137365_100102946 | 3300012201 | Vadose Zone Soil | MSEIEKQTEPVASAWMSFDKQRSLSNSVTNSAAFADFLLLKEQI* |
| Ga0137363_100365802 | 3300012202 | Vadose Zone Soil | MSAIEKKIKPIAFARQIFDRQRGLSNSVMNSAAFADFLLLKEQI* |
| Ga0137363_102085003 | 3300012202 | Vadose Zone Soil | MFSLRSVMPEIEKRTELIASVWSFAKQKGLSNSITNSAAFADFLLLKEQI* |
| Ga0137380_116066152 | 3300012206 | Vadose Zone Soil | MSEIEKQTEPIASAWMSFDKQRGLSNSVTNSAALADFLLLKEQI* |
| Ga0137378_111683392 | 3300012210 | Vadose Zone Soil | MSAIKKQTEPIASASMIFNKQMSLSNSNTNIAAFADFSLLKEQI* |
| Ga0137378_115322312 | 3300012210 | Vadose Zone Soil | MSEIEKQAEPIASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI* |
| Ga0137386_102580461 | 3300012351 | Vadose Zone Soil | QTEPVASAWMSFDKQRGLSNSVTNSAALADFLLLKEQI* |
| Ga0137390_107822591 | 3300012363 | Vadose Zone Soil | VMPAIKKQTDPFIPVWMICNRQMSLSNSVTNSAAFADFLLQKEQI* |
| Ga0137397_109256442 | 3300012685 | Vadose Zone Soil | MSAIEKQTAPIASAWMSFDKQTGLSNSVTDSSAFSDFSLLKEQI* |
| Ga0137395_100871852 | 3300012917 | Vadose Zone Soil | MPAIKKQTDTVTSVWMIFNRHMSRSNSVTNSAAFADFLLQKEQI* |
| Ga0137395_104225111 | 3300012917 | Vadose Zone Soil | EKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLMLKEQI* |
| Ga0137394_115888951 | 3300012922 | Vadose Zone Soil | MSEIEKQTEPIASAWMSFDKQRGLSDSVTNSAAFADFLLLKEQI* |
| Ga0137419_113927572 | 3300012925 | Vadose Zone Soil | MSAIKKQTESIASAWMTFNKQMSLSNSVTNSAAFADFLLLKEEI* |
| Ga0137404_102098883 | 3300012929 | Vadose Zone Soil | MSEIQKQTEPIASAWMSFDKQRGLSNSVTNSAAFADSLLLKEQI* |
| Ga0163162_119457152 | 3300013306 | Switchgrass Rhizosphere | MSAIEKQTAPIASARASFDKQTGLSNSVTNSAAFADFSLL |
| Ga0137405_14102751 | 3300015053 | Vadose Zone Soil | MSAIEKQTAPIASAWMSFVKQTGLSNSVTNSAAFADFSLPKEQI* |
| Ga0137420_11017962 | 3300015054 | Vadose Zone Soil | MSEIEKQTEPIASAWMSFDKQRGLSTSVTNSAAFADFL |
| Ga0137409_103633452 | 3300015245 | Vadose Zone Soil | MSEIEKQTEPVASAWMSFDKQRGLSTSVTNSAAFADFLLLKEQI* |
| Ga0066662_106995102 | 3300018468 | Grasslands Soil | MSEIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Ga0066669_110270892 | 3300018482 | Grasslands Soil | MSEIEKQTEPIASAWMSFDKQRGLSTSVTNSAAFADFLLLKEQI |
| Ga0137408_12101132 | 3300019789 | Vadose Zone Soil | EPVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Ga0193729_10189642 | 3300019887 | Soil | MSSIEIETEPITRVWEIFDNQRGLSNSVMNSAAFANFLLLKERI |
| Ga0179592_100242562 | 3300020199 | Vadose Zone Soil | MSEIEKQTELVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Ga0210407_1000288517 | 3300020579 | Soil | MSEIEKQTEPITSAWMNFDKQRGLSNSVTNCAAFADFLLLKEQN |
| Ga0210407_103687802 | 3300020579 | Soil | MSEIEKQTEPIASAWMIFDRQRGLSNSAMNSAALADFLLLKEQI |
| Ga0210403_100185798 | 3300020580 | Soil | MSAIRKETEPVASAMKIFDRQKGLSSSLMVSAAFADFFLLKEQI |
| Ga0210403_100538663 | 3300020580 | Soil | MSAIEKETEPIASAWKIFDRQRGPRNSVMNSAAFADFLLLKEQI |
| Ga0210403_102049142 | 3300020580 | Soil | MSAIKKQIEPIASARMIFNKQRTLSNSVTNTAAFADFLLLKEQI |
| Ga0210404_101129892 | 3300021088 | Soil | MSAIKKQIQPIASARMIFNKQRTLSNSVTNTAAFADFLLLKEQI |
| Ga0210400_106818012 | 3300021170 | Soil | LRSVISEFEKQTAPIASARMRFGKKRVLNNSVTNSAAFADFLQLKEQI |
| Ga0210400_108947252 | 3300021170 | Soil | MSEIEKQTEPIASARMSFDKQRSLGNSLTNSAAFADFLLLKEQI |
| Ga0210388_108188922 | 3300021181 | Soil | MSAIQKQTEPIDFERMIFNKQMSPSNSATNSAAFANFLLQKEQI |
| Ga0210389_108134451 | 3300021404 | Soil | LRSVMSECKKQTESIASAWMSFDKQWGLSNSVTNSAVSADFSLLKEQH |
| Ga0210386_113803622 | 3300021406 | Soil | MSECKKQTESIASAWMSFDKQWGLSNSVTNSAVSTDF |
| Ga0210383_101495582 | 3300021407 | Soil | MFAIQKQTEPIDFERMIFNKQMSPSNSATNSAAFANFLLQKEQI |
| Ga0210394_111490861 | 3300021420 | Soil | PLRGFMSAIKKQTEPIASAWMIFSKHRSLGNSITHSKAFADFLLRKEQI |
| Ga0210410_100111372 | 3300021479 | Soil | MSECKKQTESIASAWMSFDKQWGLSNSVTNSAVSADFSLLKEQH |
| Ga0137417_11208242 | 3300024330 | Vadose Zone Soil | MSEIEKQTEPVASAWMSFDKQRGLNNSVTNSAAFADFLLLKEQI |
| Ga0137417_13577755 | 3300024330 | Vadose Zone Soil | MSAIKKQTESIASAWMTFNKQMSLSNSVTNSAAFADFLLLKEQI |
| Ga0207642_102341782 | 3300025899 | Miscanthus Rhizosphere | MSEIEKQAQPIASARMIFDKQRGASNPVTNIAFADLLLLKEQL |
| Ga0209438_10369611 | 3300026285 | Grasslands Soil | SLRSVMSEIEKQTEPIASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Ga0209801_12038292 | 3300026326 | Soil | MSAIEKETEPSASAWKIFDRQRGLSNSVMNSAAFADFLLLKEQI |
| Ga0257180_10141852 | 3300026354 | Soil | MSEIEKQTEPVASAWMSFDKQRGLSTSVTNSAAFADFLLLKEQI |
| Ga0257166_10070453 | 3300026358 | Soil | MSEIEKQTEPIASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Ga0257169_10042712 | 3300026469 | Soil | MSEIEKQTEPIASAWMTFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Ga0257177_10129762 | 3300026480 | Soil | MSKIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLLLKEQI |
| Ga0257158_10445362 | 3300026515 | Soil | MSEIEKQTEPVASAWMSFDKQRGLSNSVTNSAAFADFLMLKEQI |
| Ga0209056_100001836 | 3300026538 | Soil | MSVIEKETEPSASAWKIFDRQRGLSNSVMNSAAFADFLLLKEQI |
| Ga0209648_100119737 | 3300026551 | Grasslands Soil | IEKQTAPIASAWMSFDKQKGLSNSVTNSAAFADFLLLKEQI |
| Ga0209648_100143537 | 3300026551 | Grasslands Soil | MPEIEKRTEPIASAWMSFDKQKGLSNSITNSAAFADFLLLKEQI |
| Ga0209648_100296852 | 3300026551 | Grasslands Soil | MFSLRGTMSAIEKQTAPIASAWMSFDKQKGLSNSKTNSAAFADFLLLKEQI |
| Ga0179593_10552481 | 3300026555 | Vadose Zone Soil | MSEIEKQTEPIASAWMSFDKQRGLSTSVTNSAAFA |
| Ga0209733_10325482 | 3300027591 | Forest Soil | MSSIEIETEPITRVWEIFDNQRGLSNSVMNSAAFANFLLLKEHI |
| Ga0209117_10023499 | 3300027645 | Forest Soil | MSEFEKQIEPIASAWMSFDKQRGLCNSVTNSAAFADFLLLKEQI |
| Ga0209283_105161402 | 3300027875 | Vadose Zone Soil | MSAIKKQTEPIASAWMIFNKQRSLGNSVTNSAAFADFLLLKEQI |
| Ga0209488_109941222 | 3300027903 | Vadose Zone Soil | MSAIKKQTESIASAWMIFNKRSGLSNSVTNNAAFADFLLLKEQI |
| Ga0307473_108618172 | 3300031820 | Hardwood Forest Soil | MSAIEKQTAPIASAWMSFDKQKGLSNSVTNCAAFADFFLLKEQI |
| Ga0307470_100041454 | 3300032174 | Hardwood Forest Soil | MSEIEKQTVPIASAWKIFGRQRGLSNSVMNSAAFAGFLPLKEQI |
| Ga0307472_1004670192 | 3300032205 | Hardwood Forest Soil | MSEIEKQTAPIASAWKIFDGQRGLSNAVMNSAAFAKFWLLKEQL |
| Ga0307472_1013309902 | 3300032205 | Hardwood Forest Soil | MSAIEKQTAPIASARTSFDKQTGLSNSVTDSAAFADFSLLKEQI |
| ⦗Top⦘ |