


| Basic Information | |
|---|---|
| Family ID | F101585 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MENALGEASLPSKAEEVLRKFFNEMSTFMINQSEPGIS |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.53 % |
| % of genes near scaffold ends (potentially truncated) | 57.84 % |
| % of genes from short scaffolds (< 2000 bps) | 82.35 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.725 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (14.706 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.804 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 22.55 |
| PF01152 | Bac_globin | 6.86 |
| PF00440 | TetR_N | 3.92 |
| PF13561 | adh_short_C2 | 2.94 |
| PF00230 | MIP | 2.94 |
| PF03466 | LysR_substrate | 2.94 |
| PF00106 | adh_short | 1.96 |
| PF05598 | DUF772 | 1.96 |
| PF04454 | Linocin_M18 | 1.96 |
| PF02518 | HATPase_c | 1.96 |
| PF07730 | HisKA_3 | 1.96 |
| PF00857 | Isochorismatase | 1.96 |
| PF08447 | PAS_3 | 1.96 |
| PF00578 | AhpC-TSA | 0.98 |
| PF07681 | DoxX | 0.98 |
| PF00535 | Glycos_transf_2 | 0.98 |
| PF01609 | DDE_Tnp_1 | 0.98 |
| PF05199 | GMC_oxred_C | 0.98 |
| PF04956 | TrbC | 0.98 |
| PF00589 | Phage_integrase | 0.98 |
| PF00593 | TonB_dep_Rec | 0.98 |
| PF02321 | OEP | 0.98 |
| PF13649 | Methyltransf_25 | 0.98 |
| PF08241 | Methyltransf_11 | 0.98 |
| PF08240 | ADH_N | 0.98 |
| PF09970 | DUF2204 | 0.98 |
| PF00561 | Abhydrolase_1 | 0.98 |
| PF09678 | Caa3_CtaG | 0.98 |
| PF00196 | GerE | 0.98 |
| PF02616 | SMC_ScpA | 0.98 |
| PF14014 | DUF4230 | 0.98 |
| PF12680 | SnoaL_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 22.55 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 6.86 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 2.94 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.96 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.96 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.96 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.96 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.96 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.96 |
| COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 0.98 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.98 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.98 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.98 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.98 |
| COG3838 | Type IV secretory pathway, VirB2 component (pilin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.98 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.98 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.73 % |
| Unclassified | root | N/A | 36.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001151|JGI12713J13577_1008825 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300001593|JGI12635J15846_10505158 | Not Available | 713 | Open in IMG/M |
| 3300001593|JGI12635J15846_10715689 | Not Available | 576 | Open in IMG/M |
| 3300001686|C688J18823_10011066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5917 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100004873 | All Organisms → cellular organisms → Bacteria | 10171 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100697221 | Not Available | 894 | Open in IMG/M |
| 3300004081|Ga0063454_100860594 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005541|Ga0070733_10419565 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005542|Ga0070732_10970711 | Not Available | 519 | Open in IMG/M |
| 3300005602|Ga0070762_10977913 | Not Available | 579 | Open in IMG/M |
| 3300005602|Ga0070762_11100051 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005712|Ga0070764_10444108 | Not Available | 773 | Open in IMG/M |
| 3300005921|Ga0070766_10667997 | Not Available | 702 | Open in IMG/M |
| 3300006176|Ga0070765_100063503 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
| 3300006176|Ga0070765_100326842 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300006804|Ga0079221_10356721 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300007258|Ga0099793_10072072 | Not Available | 1563 | Open in IMG/M |
| 3300009522|Ga0116218_1148532 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300009623|Ga0116133_1005607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 3166 | Open in IMG/M |
| 3300009638|Ga0116113_1198318 | Not Available | 518 | Open in IMG/M |
| 3300009764|Ga0116134_1036016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1940 | Open in IMG/M |
| 3300010880|Ga0126350_12129682 | Not Available | 527 | Open in IMG/M |
| 3300012206|Ga0137380_10669473 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300012211|Ga0137377_10485627 | Not Available | 1174 | Open in IMG/M |
| 3300012363|Ga0137390_10318340 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300012683|Ga0137398_10992900 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012923|Ga0137359_10615606 | Not Available | 951 | Open in IMG/M |
| 3300014489|Ga0182018_10276952 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300014489|Ga0182018_10438435 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300014657|Ga0181522_10960445 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300015242|Ga0137412_10600526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 833 | Open in IMG/M |
| 3300015245|Ga0137409_11127967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300017946|Ga0187879_10022560 | All Organisms → cellular organisms → Bacteria | 3875 | Open in IMG/M |
| 3300018017|Ga0187872_10165056 | Not Available | 1048 | Open in IMG/M |
| 3300018022|Ga0187864_10260798 | Not Available | 790 | Open in IMG/M |
| 3300018034|Ga0187863_10055639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2254 | Open in IMG/M |
| 3300018034|Ga0187863_10067577 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300018034|Ga0187863_10429262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 738 | Open in IMG/M |
| 3300018043|Ga0187887_10304825 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300018043|Ga0187887_10866769 | Not Available | 534 | Open in IMG/M |
| 3300018046|Ga0187851_10000243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 56105 | Open in IMG/M |
| 3300018046|Ga0187851_10386689 | Not Available | 802 | Open in IMG/M |
| 3300018047|Ga0187859_10576325 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300019240|Ga0181510_1252110 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300020021|Ga0193726_1008539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5699 | Open in IMG/M |
| 3300020021|Ga0193726_1208470 | Not Available | 818 | Open in IMG/M |
| 3300020581|Ga0210399_10583828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300020582|Ga0210395_10000055 | All Organisms → cellular organisms → Bacteria | 106197 | Open in IMG/M |
| 3300020582|Ga0210395_10266333 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300020583|Ga0210401_10895201 | Not Available | 747 | Open in IMG/M |
| 3300021088|Ga0210404_10512547 | Not Available | 678 | Open in IMG/M |
| 3300021170|Ga0210400_10040400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 3620 | Open in IMG/M |
| 3300021180|Ga0210396_10780812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300021401|Ga0210393_10097952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2332 | Open in IMG/M |
| 3300021401|Ga0210393_10146335 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300021420|Ga0210394_10527442 | Not Available | 1039 | Open in IMG/M |
| 3300021477|Ga0210398_11301934 | Not Available | 571 | Open in IMG/M |
| 3300024227|Ga0228598_1011282 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300025501|Ga0208563_1051670 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300025905|Ga0207685_10264964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300025915|Ga0207693_11335801 | Not Available | 535 | Open in IMG/M |
| 3300025939|Ga0207665_10015886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4942 | Open in IMG/M |
| 3300026317|Ga0209154_1326480 | Not Available | 503 | Open in IMG/M |
| 3300026331|Ga0209267_1230278 | Not Available | 675 | Open in IMG/M |
| 3300026340|Ga0257162_1020239 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300027064|Ga0208724_1035627 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027070|Ga0208365_1005828 | Not Available | 1485 | Open in IMG/M |
| 3300027080|Ga0208237_1026755 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300027168|Ga0208239_1013940 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300027545|Ga0209008_1006139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2848 | Open in IMG/M |
| 3300027565|Ga0209219_1102995 | Not Available | 702 | Open in IMG/M |
| 3300027590|Ga0209116_1002760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3976 | Open in IMG/M |
| 3300027609|Ga0209221_1124813 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300027619|Ga0209330_1119512 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027629|Ga0209422_1021089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1619 | Open in IMG/M |
| 3300027737|Ga0209038_10115811 | Not Available | 811 | Open in IMG/M |
| 3300027745|Ga0209908_10185735 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027745|Ga0209908_10199157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300027829|Ga0209773_10397410 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300027867|Ga0209167_10302040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604 | 866 | Open in IMG/M |
| 3300027889|Ga0209380_10384726 | Not Available | 823 | Open in IMG/M |
| 3300027905|Ga0209415_10512655 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300028036|Ga0265355_1014495 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300028746|Ga0302233_10145723 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300028776|Ga0302303_10048404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1667 | Open in IMG/M |
| 3300028806|Ga0302221_10267990 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300029882|Ga0311368_10669508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 721 | Open in IMG/M |
| 3300029914|Ga0311359_11166930 | Not Available | 507 | Open in IMG/M |
| 3300029943|Ga0311340_10771902 | Not Available | 814 | Open in IMG/M |
| 3300029943|Ga0311340_11533621 | Not Available | 520 | Open in IMG/M |
| 3300030760|Ga0265762_1003987 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
| 3300031232|Ga0302323_103404957 | Not Available | 506 | Open in IMG/M |
| 3300031525|Ga0302326_10398523 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300031708|Ga0310686_116250626 | Not Available | 677 | Open in IMG/M |
| 3300031708|Ga0310686_116573551 | Not Available | 556 | Open in IMG/M |
| 3300031788|Ga0302319_11242697 | Not Available | 684 | Open in IMG/M |
| 3300031823|Ga0307478_11277389 | Not Available | 610 | Open in IMG/M |
| 3300032160|Ga0311301_11789207 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300032174|Ga0307470_10003379 | All Organisms → cellular organisms → Bacteria | 6104 | Open in IMG/M |
| 3300032174|Ga0307470_10305665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1081 | Open in IMG/M |
| 3300033823|Ga0334837_122625 | Not Available | 517 | Open in IMG/M |
| 3300033829|Ga0334854_118826 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 14.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033823 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12713J13577_10088252 | 3300001151 | Forest Soil | MENALGEASLPSKAEEVLRKFFNDLSTFMINQSESGIS* |
| JGI12635J15846_105051581 | 3300001593 | Forest Soil | ALGEASLPSKAEEVLREFFNEMSTFMINQSESGIS* |
| JGI12635J15846_107156892 | 3300001593 | Forest Soil | MENALGEASLPSKAEEVLRKFFNEMSTFMINQSEASIS* |
| C688J18823_100110664 | 3300001686 | Soil | MENALGEGSLPSSAEEVLRKFFNEMSTFMINQSEPGIS* |
| JGIcombinedJ26739_1000048732 | 3300002245 | Forest Soil | MNNAFGEAALPAEAEQVLRKFFDGMSSFMINQAEPGVR* |
| JGIcombinedJ26739_1006972211 | 3300002245 | Forest Soil | MXAFGEAALPKEAEQVLRKFLDRMSTFMINQSESGIS* |
| Ga0063454_1008605941 | 3300004081 | Soil | MRLMENALGEGSLPSSAEEVLRKFFNEMSTFMINQSEPGIS* |
| Ga0070733_104195651 | 3300005541 | Surface Soil | MRLMENALGEASLPSKAEEVLRKFFNEMSTFMINQSE |
| Ga0070732_109707111 | 3300005542 | Surface Soil | LGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS* |
| Ga0070762_109779132 | 3300005602 | Soil | AFGEAALPKEAEQVLRKFLDRMSTFMINQSESGIS* |
| Ga0070762_111000512 | 3300005602 | Soil | MRDHWMRLMDNALGEASLPSRAEEVLRKFFDEMSAFMINQSEARIS* |
| Ga0070764_104441081 | 3300005712 | Soil | MRAFGEAAPPKEAEQVLLTFLDRMSTFMINQSESGII* |
| Ga0070766_106679972 | 3300005921 | Soil | MRAFGEAALPKETEQVLLKFLDQMSTFMINQSESGIS* |
| Ga0070765_1000635031 | 3300006176 | Soil | DRWMRLMNSAFGEAALPAEAEQVLRKFLDGMSSFMINHLEA* |
| Ga0070765_1003268422 | 3300006176 | Soil | MNSAFGEAALPEKAEQVLRKFLDEMSTFMINQPEP* |
| Ga0079221_103567212 | 3300006804 | Agricultural Soil | MRLMENALEEASLPSKAEEVLRKFFNEMSTFMINQSESGMS* |
| Ga0099793_100720722 | 3300007258 | Vadose Zone Soil | ENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS* |
| Ga0116218_11485322 | 3300009522 | Peatlands Soil | MNSAFGEAALPEEAEQVLRKFLDEMSTFMINQPEPGMR* |
| Ga0116133_10056072 | 3300009623 | Peatland | MRLMDNALGEASLPSKAEEVLRKFFNEMSTFMINQSEPRIS* |
| Ga0116113_11983182 | 3300009638 | Peatland | RLMENALREASLPSKAEEVLRKFFNEMSTFMINQSESGIS* |
| Ga0116134_10360163 | 3300009764 | Peatland | MRLMDNALGEASLPSKAEEVLRKFFNEMSTFMINQS |
| Ga0126350_121296822 | 3300010880 | Boreal Forest Soil | RLMNSAFGEAALPAEAEQVLRKFLDGMSTFMINRVEP* |
| Ga0137380_106694731 | 3300012206 | Vadose Zone Soil | MRLMENALGEASLPSKAEEVLRKFFNEMSTFMINQSESGIS* |
| Ga0137377_104856271 | 3300012211 | Vadose Zone Soil | MQLMENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS* |
| Ga0137390_103183403 | 3300012363 | Vadose Zone Soil | MENALGEASLPSKAEEVLRKFFNEMSTFMINQSEPGIS* |
| Ga0137398_109929002 | 3300012683 | Vadose Zone Soil | MRLMNRAFEEAALPGEAEQVLRKFLDGMSSFMINQVEQ* |
| Ga0137359_106156062 | 3300012923 | Vadose Zone Soil | MQLMDNALGKASLPSKAEEVLRKFFDEMSTFMINQPEAKKT* |
| Ga0182018_102769522 | 3300014489 | Palsa | MHLMNSAFGEAALPEEAEQVLRKFFDEMSTFMINRPEPGTR* |
| Ga0182018_104384352 | 3300014489 | Palsa | MHLMNSALGEAALPEKAEQVLRKFFNEMSTFMINQSESATR* |
| Ga0181522_109604452 | 3300014657 | Bog | LMDNALGEASLPSKAEEVLRKFFNEMSTFMINQSEPRIS* |
| Ga0137412_106005262 | 3300015242 | Vadose Zone Soil | MRLMDSAFGEAALPAEAEQVLRKFLDEMSSFMINWAEP* |
| Ga0137409_111279672 | 3300015245 | Vadose Zone Soil | LMNSAFGEAALPGEAEQVLRKFLDGMSSFMINQVDPGVR* |
| Ga0187879_100225602 | 3300017946 | Peatland | MRLMDNALGEASLPSKAEEVLRKFFNEMSTFMINQSEPRIS |
| Ga0187872_101650562 | 3300018017 | Peatland | MRLMENALGEASLPSNAEEVLRKFFNEMSTFMINQSEASIS |
| Ga0187864_102607981 | 3300018022 | Peatland | RLMENALGEASLPSRAEEVLRKFFNEMSTFMINQSEASIS |
| Ga0187863_100556392 | 3300018034 | Peatland | MENALGEASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0187863_100675771 | 3300018034 | Peatland | MDNALGEASLPSRAEEVLRKFFKEMSTFMINQSEARIS |
| Ga0187863_104292623 | 3300018034 | Peatland | MENALGEASLPSNAEGVLRKFFNEMSTFMINQSEP |
| Ga0187887_103048251 | 3300018043 | Peatland | RDRRMRLMDNALGEASRPSRAEEVLRKFFKEMSTFMINQSEARIS |
| Ga0187887_108667692 | 3300018043 | Peatland | WMRAFGEAALPKEAEQVLRTFLDRMSTFTINQSESGIS |
| Ga0187851_100002432 | 3300018046 | Peatland | MENALGEASLPSRAEEVLRKFFNEMSTFMINQSEASIS |
| Ga0187851_103866892 | 3300018046 | Peatland | MENALREASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0187859_105763251 | 3300018047 | Peatland | MRLMENALGEASLPSKAEEVLQKFFSEMSTFMINQSESRNS |
| Ga0181510_12521102 | 3300019240 | Peatland | MRLMDNALGEASLPSKAEEVLRKFFNEMSTFLINQSEPRIS |
| Ga0193726_10085395 | 3300020021 | Soil | MENALGEASLPSKAEEFLRKFFNEMSTFMINQSESGIS |
| Ga0193726_12084702 | 3300020021 | Soil | RLMDNAFGEAALPAEAEQILRTFLDGMSSFMINRAES |
| Ga0210399_105838281 | 3300020581 | Soil | MDGAFGEAALPAEAEQVLRKFLDGMSSFMINRAEP |
| Ga0210395_100000554 | 3300020582 | Soil | MENALGEASLPGRAEEVLRKFFDEMSTFMINQSEARIS |
| Ga0210395_102663332 | 3300020582 | Soil | MRAFGEAALPKETEQVLLKFLDQMSTFMINQSESGIS |
| Ga0210401_108952012 | 3300020583 | Soil | MRLMDSAFGEAALPAEAEQILRKFLDGMSSFMINRVEP |
| Ga0210404_105125472 | 3300021088 | Soil | MENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS |
| Ga0210400_100404001 | 3300021170 | Soil | RLMENALGEASLPSKAEKVLRKFFTETSTFMINQSETGIS |
| Ga0210396_107808122 | 3300021180 | Soil | LMNNAFGEAALPAEAEQVLRKFFDGMSSFMINQAEPGVR |
| Ga0210393_100979522 | 3300021401 | Soil | MENALREVSLPSNAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0210393_101463352 | 3300021401 | Soil | MNSAFGEAALPEKAEQVLRKFLDEMSTFMINQPEP |
| Ga0210394_105274421 | 3300021420 | Soil | MRAFGEAALPKEAEQVLRKFLGEMSTFMINRVEPGMH |
| Ga0210398_113019342 | 3300021477 | Soil | NALGEASLPSKAEEVLRKFFNEMSIFMINQSESGIS |
| Ga0228598_10112822 | 3300024227 | Rhizosphere | MRLMENALGEASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0208563_10516702 | 3300025501 | Peatland | MRLMDNALGEASLPSKAEEVLRKFFNEMSTFMINQSEASIS |
| Ga0207685_102649642 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LMDSAFEEAALPEKAEQVLRKFLDEMSTFMINQPEPGMR |
| Ga0207693_113358011 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NALEEASLPSNAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0207665_100158861 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RLMENALGEASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0209154_13264801 | 3300026317 | Soil | WMRLMENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS |
| Ga0209267_12302781 | 3300026331 | Soil | MENALGEASLPSNAEEVLRKFFNDMSTFMINQSEPGIS |
| Ga0257162_10202392 | 3300026340 | Soil | MQLMENALGEASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0208724_10356272 | 3300027064 | Forest Soil | MENALGEASLPSKAEEVLRKFFNEMSTFMINQSESG |
| Ga0208365_10058281 | 3300027070 | Forest Soil | MRLMENALGEASLPSQAEEVLRKFFNEMSTFMINQSDPGIS |
| Ga0208237_10267551 | 3300027080 | Forest Soil | MDNALGEASLPSGAEEVLRTFFNEMSTFMINQSEARIS |
| Ga0208239_10139401 | 3300027168 | Forest Soil | MRAFGEAAPPKEAEQVLLTFLDRMSTFMINQSESGII |
| Ga0209008_10061392 | 3300027545 | Forest Soil | MENALGEASLPSKAEEVLRKFFNDLSTFMINQSESGIS |
| Ga0209219_11029952 | 3300027565 | Forest Soil | NALGEASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0209116_10027602 | 3300027590 | Forest Soil | MENALGEASLPSNAEEVLRKFFNEMSTFMINQSEARIS |
| Ga0209221_11248132 | 3300027609 | Forest Soil | QDWMRAFVEAALPKEAEQVLRKFLDRMSTFVINQSESGIS |
| Ga0209330_11195122 | 3300027619 | Forest Soil | ENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS |
| Ga0209422_10210891 | 3300027629 | Forest Soil | ENALGEASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0209038_101158111 | 3300027737 | Bog Forest Soil | ALGEASLPSNAEEVLRKFFNEMSTFMINQSEAGIS |
| Ga0209908_101857351 | 3300027745 | Thawing Permafrost | MRLMNSAFGEAALPEKAEQVLRKFLEEMSTFMINQPEPGMR |
| Ga0209908_101991572 | 3300027745 | Thawing Permafrost | MRLMDNALREASLPSRAEEVLRKFFNEMSTFMINQSEARIS |
| Ga0209773_103974102 | 3300027829 | Bog Forest Soil | MGLMENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS |
| Ga0209167_103020401 | 3300027867 | Surface Soil | MRLMENALGEASLPSKAEEVLRKFFNEMSTFMINQSESGI |
| Ga0209380_103847262 | 3300027889 | Soil | MRLMENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS |
| Ga0209415_105126552 | 3300027905 | Peatlands Soil | MNSAFGEAALPEEAEQVLRKFLDEMSTFMINQPEPGMR |
| Ga0265355_10144951 | 3300028036 | Rhizosphere | MDNALGEASLPSRAEEVLRKFFNEMSTFMINQSEARIS |
| Ga0302233_101457231 | 3300028746 | Palsa | DNALGEASLPSKAEEVLWKFFNETSTFMINQSEAGIS |
| Ga0302303_100484043 | 3300028776 | Palsa | MRLMNSAFGEAALPEDAEQVLRKFLDEMSTFMINQPEPGMR |
| Ga0302221_102679901 | 3300028806 | Palsa | MDNALGEASLPSSAEEVLREFFNEMSTFMINQSEARIS |
| Ga0311368_106695081 | 3300029882 | Palsa | RLMNSAFGEAALPEDAEQVLRKFLDEMSTFMINQPEPGMR |
| Ga0311359_111669301 | 3300029914 | Bog | LMENALREASLPSKAEEVLRKFFNEMSTFMINQSESGIS |
| Ga0311340_107719022 | 3300029943 | Palsa | RLMENALGEASLPSNAEEVLRKFFNEMSTFMINQSEPGIS |
| Ga0311340_115336211 | 3300029943 | Palsa | RLMDNALGKASLPGEAEQVLRKFFNEMSTFMINQP |
| Ga0265762_10039874 | 3300030760 | Soil | MRLMNSAFAEAALPAEAEQVLRKFLDGMSSFMINQVEPGVG |
| Ga0302323_1034049571 | 3300031232 | Fen | DRWMRLMDSAFGEAALPAEAEQVLRKFLDEMSSFMINWAEP |
| Ga0302326_103985235 | 3300031525 | Palsa | MRLMNNAFEEAALSAETEQVLRKFHDEMSTFMINQPEPGMR |
| Ga0310686_1162506262 | 3300031708 | Soil | MNNAFGEAALPAEAEQVLRKFLDGMSSFMINQAEPGVR |
| Ga0310686_1165735512 | 3300031708 | Soil | AFGEAALPKEAEQVLRKFLDQMSTFMINQSKSGIS |
| Ga0302319_112426972 | 3300031788 | Bog | ALGEAALPSRAEEVLRKFFNEMSTFMINQSEARIS |
| Ga0307478_112773892 | 3300031823 | Hardwood Forest Soil | MRLMENALGEASLPSKAEEVLRKFFNEMATFMINQSEPGIS |
| Ga0311301_117892071 | 3300032160 | Peatlands Soil | MGLMNSAFEEAALPGEAEQVLRKFLDGMSSFMINRVEPGVR |
| Ga0307470_100033796 | 3300032174 | Hardwood Forest Soil | MENALGEDSLPSKAEDVLRKFLNEMSTFMINQSES |
| Ga0307470_103056652 | 3300032174 | Hardwood Forest Soil | ALGEASLPSKAEEVLRKFFNEMSTFMINQSEPGIS |
| Ga0334837_122625_406_516 | 3300033823 | Soil | LMNSAVGEAALPAEAEQVLRKFFDGMSSFMINRVEP |
| Ga0334854_118826_107_223 | 3300033829 | Soil | MNSAFGVAALPVEAEQVLRKFLDEMSTFMINHPEPGTR |
| ⦗Top⦘ |