


| Basic Information | |
|---|---|
| Family ID | F101565 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 38 residues |
| Representative Sequence | GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.90 % |
| % of genes near scaffold ends (potentially truncated) | 94.12 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.569 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.569 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.549 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.23% β-sheet: 0.00% Coil/Unstructured: 70.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01568 | Molydop_binding | 20.59 |
| PF09084 | NMT1 | 7.84 |
| PF03819 | MazG | 4.90 |
| PF03401 | TctC | 2.94 |
| PF03749 | SfsA | 2.94 |
| PF04955 | HupE_UreJ | 2.94 |
| PF01471 | PG_binding_1 | 1.96 |
| PF09351 | DUF1993 | 1.96 |
| PF00072 | Response_reg | 0.98 |
| PF00120 | Gln-synt_C | 0.98 |
| PF00994 | MoCF_biosynth | 0.98 |
| PF04392 | ABC_sub_bind | 0.98 |
| PF13379 | NMT1_2 | 0.98 |
| PF00107 | ADH_zinc_N | 0.98 |
| PF07859 | Abhydrolase_3 | 0.98 |
| PF13545 | HTH_Crp_2 | 0.98 |
| PF00596 | Aldolase_II | 0.98 |
| PF03459 | TOBE | 0.98 |
| PF13620 | CarboxypepD_reg | 0.98 |
| PF01494 | FAD_binding_3 | 0.98 |
| PF01566 | Nramp | 0.98 |
| PF12706 | Lactamase_B_2 | 0.98 |
| PF00144 | Beta-lactamase | 0.98 |
| PF11941 | DUF3459 | 0.98 |
| PF07995 | GSDH | 0.98 |
| PF04909 | Amidohydro_2 | 0.98 |
| PF13450 | NAD_binding_8 | 0.98 |
| PF01503 | PRA-PH | 0.98 |
| PF00753 | Lactamase_B | 0.98 |
| PF03972 | MmgE_PrpD | 0.98 |
| PF08241 | Methyltransf_11 | 0.98 |
| PF07883 | Cupin_2 | 0.98 |
| PF03330 | DPBB_1 | 0.98 |
| PF01425 | Amidase | 0.98 |
| PF03466 | LysR_substrate | 0.98 |
| PF13407 | Peripla_BP_4 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.84 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.84 |
| COG1489 | DNA-binding protein, stimulates sugar fermentation | Signal transduction mechanisms [T] | 2.94 |
| COG2370 | Hydrogenase/urease accessory protein HupE | Posttranslational modification, protein turnover, chaperones [O] | 2.94 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.94 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.96 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.98 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.98 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.98 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.98 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.98 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.98 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.98 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.98 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.98 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.57 % |
| Unclassified | root | N/A | 28.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_10154900 | Not Available | 925 | Open in IMG/M |
| 3300005471|Ga0070698_100154928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2237 | Open in IMG/M |
| 3300005471|Ga0070698_101680384 | Not Available | 587 | Open in IMG/M |
| 3300005533|Ga0070734_10807348 | Not Available | 533 | Open in IMG/M |
| 3300005568|Ga0066703_10327356 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005764|Ga0066903_100457453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2137 | Open in IMG/M |
| 3300005764|Ga0066903_101840488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1158 | Open in IMG/M |
| 3300005764|Ga0066903_107721668 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300006057|Ga0075026_100661741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 620 | Open in IMG/M |
| 3300006176|Ga0070765_100601488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1037 | Open in IMG/M |
| 3300006196|Ga0075422_10551044 | Not Available | 529 | Open in IMG/M |
| 3300006806|Ga0079220_11824629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300006847|Ga0075431_101348282 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006880|Ga0075429_101791352 | Not Available | 533 | Open in IMG/M |
| 3300006914|Ga0075436_100097112 | Not Available | 2050 | Open in IMG/M |
| 3300006969|Ga0075419_10300580 | Not Available | 1082 | Open in IMG/M |
| 3300009143|Ga0099792_11144101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 526 | Open in IMG/M |
| 3300009162|Ga0075423_10617372 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300009176|Ga0105242_12532878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17 | 561 | Open in IMG/M |
| 3300009792|Ga0126374_10369369 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300010046|Ga0126384_11760325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300010360|Ga0126372_10526874 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300010361|Ga0126378_13089379 | Not Available | 530 | Open in IMG/M |
| 3300010366|Ga0126379_10389418 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300010376|Ga0126381_102437731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300010376|Ga0126381_103549122 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010376|Ga0126381_103853110 | Not Available | 585 | Open in IMG/M |
| 3300010376|Ga0126381_104247989 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010391|Ga0136847_10561410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300010398|Ga0126383_10145259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2203 | Open in IMG/M |
| 3300010398|Ga0126383_11384425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300010398|Ga0126383_11713713 | Not Available | 717 | Open in IMG/M |
| 3300010400|Ga0134122_13082080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300011422|Ga0137425_1010759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1836 | Open in IMG/M |
| 3300012189|Ga0137388_10013603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5868 | Open in IMG/M |
| 3300012201|Ga0137365_10031808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4049 | Open in IMG/M |
| 3300012212|Ga0150985_117544797 | Not Available | 591 | Open in IMG/M |
| 3300012469|Ga0150984_121810320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1626 | Open in IMG/M |
| 3300012685|Ga0137397_10332201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1133 | Open in IMG/M |
| 3300012930|Ga0137407_10115108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2327 | Open in IMG/M |
| 3300012930|Ga0137407_10439808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1212 | Open in IMG/M |
| 3300012930|Ga0137407_11164875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300012955|Ga0164298_10524878 | Not Available | 797 | Open in IMG/M |
| 3300012957|Ga0164303_10998449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300012971|Ga0126369_11372717 | Not Available | 797 | Open in IMG/M |
| 3300012971|Ga0126369_13161940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300012976|Ga0134076_10638224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300012984|Ga0164309_11311596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300012988|Ga0164306_10560449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 889 | Open in IMG/M |
| 3300014497|Ga0182008_10502031 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300014880|Ga0180082_1003848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2931 | Open in IMG/M |
| 3300015242|Ga0137412_10299282 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300016270|Ga0182036_11719257 | Not Available | 530 | Open in IMG/M |
| 3300016404|Ga0182037_10340507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1218 | Open in IMG/M |
| 3300016404|Ga0182037_10661932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300016422|Ga0182039_10431941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1125 | Open in IMG/M |
| 3300016422|Ga0182039_11190445 | Not Available | 688 | Open in IMG/M |
| 3300017792|Ga0163161_11431710 | Not Available | 604 | Open in IMG/M |
| 3300017792|Ga0163161_11793224 | Not Available | 545 | Open in IMG/M |
| 3300018433|Ga0066667_10173968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1550 | Open in IMG/M |
| 3300019889|Ga0193743_1123412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13 | 931 | Open in IMG/M |
| 3300021171|Ga0210405_11327526 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021178|Ga0210408_10199882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1589 | Open in IMG/M |
| 3300021178|Ga0210408_10481761 | Not Available | 987 | Open in IMG/M |
| 3300021403|Ga0210397_10700145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300021420|Ga0210394_11855369 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021444|Ga0213878_10468825 | Not Available | 552 | Open in IMG/M |
| 3300021475|Ga0210392_11395183 | Not Available | 524 | Open in IMG/M |
| 3300021476|Ga0187846_10271587 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300021477|Ga0210398_10045667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3613 | Open in IMG/M |
| 3300025915|Ga0207693_10014313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 6383 | Open in IMG/M |
| 3300025934|Ga0207686_11454759 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300025937|Ga0207669_10926046 | Not Available | 729 | Open in IMG/M |
| 3300025961|Ga0207712_11742720 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026089|Ga0207648_10831874 | Not Available | 860 | Open in IMG/M |
| 3300026121|Ga0207683_11756512 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026295|Ga0209234_1273754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300026538|Ga0209056_10148175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1803 | Open in IMG/M |
| 3300027862|Ga0209701_10067606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2266 | Open in IMG/M |
| 3300027886|Ga0209486_10112605 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300027903|Ga0209488_10004460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10934 | Open in IMG/M |
| 3300028047|Ga0209526_10276810 | Not Available | 1141 | Open in IMG/M |
| 3300028814|Ga0307302_10264829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300030904|Ga0308198_1089656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300031226|Ga0307497_10012578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2443 | Open in IMG/M |
| 3300031564|Ga0318573_10041642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2204 | Open in IMG/M |
| 3300031713|Ga0318496_10144298 | Not Available | 1297 | Open in IMG/M |
| 3300031724|Ga0318500_10092815 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300031724|Ga0318500_10330296 | Not Available | 750 | Open in IMG/M |
| 3300031744|Ga0306918_10245423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1365 | Open in IMG/M |
| 3300031765|Ga0318554_10650126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 593 | Open in IMG/M |
| 3300031778|Ga0318498_10230627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300031779|Ga0318566_10090851 | Not Available | 1492 | Open in IMG/M |
| 3300031779|Ga0318566_10303783 | Not Available | 789 | Open in IMG/M |
| 3300031821|Ga0318567_10051512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2128 | Open in IMG/M |
| 3300031835|Ga0318517_10009961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3371 | Open in IMG/M |
| 3300031879|Ga0306919_10656283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300031942|Ga0310916_10643742 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300031946|Ga0310910_10779867 | Not Available | 753 | Open in IMG/M |
| 3300032090|Ga0318518_10456686 | Not Available | 654 | Open in IMG/M |
| 3300033290|Ga0318519_10014215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3383 | Open in IMG/M |
| 3300034268|Ga0372943_0113994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1606 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_101549004 | 3300000890 | Soil | KGLNQVIRVMAEAGQLHAPLPAAERFVDLQYLRAAGLMK* |
| Ga0070698_1001549281 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LKGLSQVIQFMGETGDLKPPLASAERFVDLQYLRAAGLQ* |
| Ga0070698_1016803841 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RAVARCVIPLLPRETGDLKPPLPPAERFVDLQYLRAAGIQ* |
| Ga0070734_108073481 | 3300005533 | Surface Soil | DFAGLKQVIAFMAEARLIAPPLPLPERFVDLQYLRAAAIE* |
| Ga0066703_103273561 | 3300005568 | Soil | CMIPLLPRETGDLKPPLPPAERFVDLQYLRAAGIQ* |
| Ga0066903_1004574531 | 3300005764 | Tropical Forest Soil | DLKGFKTAIEFMGEAGVLKAPLPPPERFVDLQYLRAAGVQ* |
| Ga0066903_1018404882 | 3300005764 | Tropical Forest Soil | TAIEFMGEAEVLKAPLPPPERFVDLQYLRAAGLQ* |
| Ga0066903_1077216683 | 3300005764 | Tropical Forest Soil | GFKTAIEFMGEAGVLKAPLPPPERFVDLQYLRAAGLQ* |
| Ga0075026_1006617411 | 3300006057 | Watersheds | EVIALMAEAGMLKAPLPVAERFVDLQYLRAAGLQ* |
| Ga0070765_1006014881 | 3300006176 | Soil | AVIALLGRTGELKAPLPAAERFVDLQYLKAAGLQ* |
| Ga0075422_105510441 | 3300006196 | Populus Rhizosphere | EQVIAMMGEGGILAPPLPPADRFVDLQFLQAAGIQ* |
| Ga0079220_118246291 | 3300006806 | Agricultural Soil | QAIALMGEGGILKGPLPRAERFVDLQYLQAAGVQ* |
| Ga0075431_1013482821 | 3300006847 | Populus Rhizosphere | PKGLAQVIAFMADAGHLQPPLPDAERFVDLGYLARAGVR* |
| Ga0075429_1017913522 | 3300006880 | Populus Rhizosphere | PKGVAQVIAFMADAGQIQPPLPHAERFVDLSYLARAGVR* |
| Ga0075436_1000971121 | 3300006914 | Populus Rhizosphere | GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ* |
| Ga0075419_103005801 | 3300006969 | Populus Rhizosphere | GFNRVIQIMAEAGEVKPPLPSAERFVDLQYLHAAGLMK* |
| Ga0099792_111441012 | 3300009143 | Vadose Zone Soil | QVIAMLGEAGALKPPLPKPEQFVDLQYLRAGGLQ* |
| Ga0075423_106173721 | 3300009162 | Populus Rhizosphere | LKGFRTAIEFLGEASVLKAPLPPVERFVDLQYLRAAGLQ* |
| Ga0105242_125328781 | 3300009176 | Miscanthus Rhizosphere | VAQVIAFMADAGQIQPPLPDAERFVDLRFLARAGVAPR* |
| Ga0126374_103693691 | 3300009792 | Tropical Forest Soil | AGEINIKGMEQVIAMMGEGGVLAPPLPAADRFVDLQFLQAAGIQ* |
| Ga0126384_117603251 | 3300010046 | Tropical Forest Soil | LRGMEQVIAMMGEGGVLAPPLPPADRFVDLQFLQAAGIQ* |
| Ga0126372_105268743 | 3300010360 | Tropical Forest Soil | AGEINIKGMEQVIAMMGEGGVLAPPLPAADRFVDLQFLQAAGSQ* |
| Ga0126378_130893791 | 3300010361 | Tropical Forest Soil | VSAVIALLGRTGELTASLPAAERFVDLQYLEAAGLQ* |
| Ga0126379_103894181 | 3300010366 | Tropical Forest Soil | LKGLAQAITLMGEAGTLKGPLPPAERFVDLQYLRLAGFQ* |
| Ga0126381_1024377311 | 3300010376 | Tropical Forest Soil | LKQVITLMSEAGNLKPPLPAAERFVDAQYLKDAGVE* |
| Ga0126381_1035491221 | 3300010376 | Tropical Forest Soil | ELNLNGLTQVSAFMGEAGTIESPLGAAGRFVDLQYLEAAGVR* |
| Ga0126381_1038531101 | 3300010376 | Tropical Forest Soil | GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAEVQ* |
| Ga0126381_1042479892 | 3300010376 | Tropical Forest Soil | GAPARVVAMMAQAGLLKPPLPSAQRFVDLQYLRAAGLQ* |
| Ga0136847_105614102 | 3300010391 | Freshwater Sediment | GQVIQFMGEAGELKPPLPAPERFVDLQYLQAAGVY* |
| Ga0126383_101452594 | 3300010398 | Tropical Forest Soil | QVVAMMAETGALSPPLPAPETFVDRQYLQAAGVN* |
| Ga0126383_113844252 | 3300010398 | Tropical Forest Soil | QAIALMGEAGTLKGPLPPAERFVDLQYLRLAGFQ* |
| Ga0126383_117137131 | 3300010398 | Tropical Forest Soil | TAIEFMGEAGVLKEPLPPPERFVDLQYLHAAGVQ* |
| Ga0134122_130820801 | 3300010400 | Terrestrial Soil | SFAQVIAFMVEAGQLKPPLPAAERFVDLQYLEAAGVR* |
| Ga0137425_10107593 | 3300011422 | Soil | QVIAFMAEAGQLKAPLPLPERFVDLQYLRLAGVR* |
| Ga0137388_100136034 | 3300012189 | Vadose Zone Soil | LELVIAMMGEGGALKAPLPQAERFVDLQYLRAAGVQ* |
| Ga0137365_100318083 | 3300012201 | Vadose Zone Soil | MEQVIALMGESETIKAPLPAVERFVDLQYLHAAGVQ* |
| Ga0150985_1175447971 | 3300012212 | Avena Fatua Rhizosphere | ADLAQVIAFMGDGGMLAQPLPPPERFVDPQYLKAAGAE* |
| Ga0150984_1218103203 | 3300012469 | Avena Fatua Rhizosphere | LAQVIAMMADAGAIKTPLPSPEQFVDLQYLRTAGVP* |
| Ga0137397_103322013 | 3300012685 | Vadose Zone Soil | RAVSRCMIPLLPRETGDLKPPLPPAERFVDLQYLRAAGIQ* |
| Ga0137407_101151084 | 3300012930 | Vadose Zone Soil | ATAIEFMGEAGVLKAPLPPVERFVDLQYLRAAGLQ* |
| Ga0137407_104398082 | 3300012930 | Vadose Zone Soil | KALDQVIAMLGEAGALKAPLPSAERFVDLQYLRAAGVQ* |
| Ga0137407_111648752 | 3300012930 | Vadose Zone Soil | GQVIQFMAEAGELKPPLPQPERFVDLQYLQAAGLQ* |
| Ga0164298_105248782 | 3300012955 | Soil | GMEQAIALMGEGGILKAPLPRAERFVDLQYLQAAGVQ* |
| Ga0164303_109984491 | 3300012957 | Soil | MTKVIELLGQTGELKGPLPAAERFVDLQYLEAAGMR* |
| Ga0126369_113727171 | 3300012971 | Tropical Forest Soil | GEINLRGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAEVQ* |
| Ga0126369_131619401 | 3300012971 | Tropical Forest Soil | QVIAMMGDAGTLGSPLPSPQQFVDLQYLHAAGIQ* |
| Ga0134076_106382241 | 3300012976 | Grasslands Soil | KGLGQVIQFMGETGDLKPPLPSAERFVDLQYLRAVGIQ* |
| Ga0164309_113115963 | 3300012984 | Soil | ELAGIAQVITFMAEAGQLKPPLPAPERFVDLRYQRR* |
| Ga0164306_105604491 | 3300012988 | Soil | LAQVIAMMSDAGAIKTPLPSPEQFVDLQYLRRAGVP* |
| Ga0182008_105020311 | 3300014497 | Rhizosphere | EQVIALMGEGGVLEPPLPPAERFVDLQFLAAAGVQ* |
| Ga0180082_10038484 | 3300014880 | Soil | AQVIAFMAEAGQLKAPLPLPERFVDLQYLRLAGVR* |
| Ga0137412_102992822 | 3300015242 | Vadose Zone Soil | MEQAITLMGESGVIKAPLPAAERFVDLQYLRAAGVQ* |
| Ga0182036_117192572 | 3300016270 | Soil | NGLEQVIAMMAEARTLNPPLPSADRFVDLQYLRATGVQ |
| Ga0182037_103405071 | 3300016404 | Soil | KLGEINLKGMEQVIALMAEGETINAPVPAAERFVDLQYLHAAGVQ |
| Ga0182037_106619323 | 3300016404 | Soil | EQVIAMMAKARTLNPPLPSAERFVDLQYLRSAGVQ |
| Ga0182039_104319412 | 3300016422 | Soil | LGEINLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0182039_111904451 | 3300016422 | Soil | GILPKLGEINLKGMEQVIALMAEGETIKPPLPAAERFGDLQYLHAAGVQ |
| Ga0163161_114317102 | 3300017792 | Switchgrass Rhizosphere | DPKGVAQVIAFMADAGQIQPPLPDAERFVDLRFLARAGVAPR |
| Ga0163161_117932242 | 3300017792 | Switchgrass Rhizosphere | AQVIAFMGEGGMLAQPLPPPERFVDPQYLKAAGAE |
| Ga0066667_101739681 | 3300018433 | Grasslands Soil | DIKGLGQVIQFMGETGDLKPPLPSAERFVDLQYLRAVGIQ |
| Ga0193743_11234123 | 3300019889 | Soil | FVREGIIVEMISIEAETGDLKPPLPSAERFVDLQYLRAAGIQ |
| Ga0210405_113275262 | 3300021171 | Soil | AQVIAFMTDGGAIKPPLPAPEQFVDLQYLRAAGAQ |
| Ga0210408_101998821 | 3300021178 | Soil | GMEQVIALMGESATIKAPLPAAERFVDLQYLHAAGVQ |
| Ga0210408_104817611 | 3300021178 | Soil | NLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0210397_107001452 | 3300021403 | Soil | PKLGEISLKGMEQAIALMAEGGMIKPPLPAAEQFADLQYLRAVGVP |
| Ga0210394_118553691 | 3300021420 | Soil | ELEALEQVIALMGEAGNLKAPLPSAERFVDTQYLRAAGAQ |
| Ga0213878_104688252 | 3300021444 | Bulk Soil | LKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0210392_113951831 | 3300021475 | Soil | VGNVIELLGRSGELKAPLPAAERFTDLQYLEAAGLQ |
| Ga0187846_102715871 | 3300021476 | Biofilm | GLQQVIAMMGEEGLIGKPPPQASRFVDLQYLHAAGVQ |
| Ga0210398_100456675 | 3300021477 | Soil | GQVIAFMGEGGTIKPPLPAPEQFVDLQYLRAAGAQ |
| Ga0207693_100143131 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RGMEQVIALMGESATIKAPLPAAERFVDLQYLHAAGVQ |
| Ga0207686_114547592 | 3300025934 | Miscanthus Rhizosphere | EQVIAFMGEAGNLTPPLPAAERFVDLQYLHAAGIK |
| Ga0207669_109260461 | 3300025937 | Miscanthus Rhizosphere | QVIAFMADAGQIQPPLPDAERFVDLRFLARAGVAPR |
| Ga0207712_117427202 | 3300025961 | Switchgrass Rhizosphere | LKGMEQVIAFMREAGTLNEPVPTAERFTDLQYLRLAGIK |
| Ga0207648_108318741 | 3300026089 | Miscanthus Rhizosphere | AQVIAFMGEGGMLPQPLPPPERFVDPQYLKAAGAE |
| Ga0207683_117565121 | 3300026121 | Miscanthus Rhizosphere | MAQVIAFMAEAGTVKAPLPAPERFFDLRYLQSALPK |
| Ga0209234_12737543 | 3300026295 | Grasslands Soil | MEQVIALMGESETIKAPLPAVERFVDLQYLHAAGVQ |
| Ga0209056_101481751 | 3300026538 | Soil | EINLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0209701_100676063 | 3300027862 | Vadose Zone Soil | LELVIAMMGEGGALKAPLPQAERFVDLQYLRAAGVQ |
| Ga0209486_101126051 | 3300027886 | Agricultural Soil | KGLAQVIAFMAEAGQIQPPLPDVERFVDLSYLARAGVR |
| Ga0209488_1000446012 | 3300027903 | Vadose Zone Soil | DPKGFSAAIEFMGEAGVLKPPFPKPDQFIDLQYLQAAGIQ |
| Ga0209526_102768101 | 3300028047 | Forest Soil | AGLAKVIELLAETGQIGAPPPPAERFVDLQYLQAAGLQ |
| Ga0307302_102648293 | 3300028814 | Soil | QQAIALMEEGGLLAQPLPAAERFIDLQYLRAAGIQ |
| Ga0308198_10896561 | 3300030904 | Soil | KGMEQAITLMGESGVIKAPLPAAERFVDLQYLRAAGVQ |
| Ga0307497_100125784 | 3300031226 | Soil | AQVIAMMRDAGAIKTPLPSPEQFVDLQYLRAAGVP |
| Ga0318573_100416422 | 3300031564 | Soil | INLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0318496_101442982 | 3300031713 | Soil | LNGMEQVIALMAEGETINAPLPAAERFVDLQYLHAAGVQ |
| Ga0318500_100928152 | 3300031724 | Soil | INLRGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0318500_103302962 | 3300031724 | Soil | TGMEQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ |
| Ga0306918_102454231 | 3300031744 | Soil | LAGLKEVIALMGEAGNLKPPLPSAERFVDTRYLQAAGLQ |
| Ga0318554_106501261 | 3300031765 | Soil | MQQAIAMLGESGVIKPPLPGAERFVDLQYLQAAGIQ |
| Ga0318498_102306272 | 3300031778 | Soil | LKEVIALMGEAGNLKPPLPSAERFVDTQYLRAAGLQ |
| Ga0318566_100908512 | 3300031779 | Soil | GMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0318566_103037831 | 3300031779 | Soil | LRGMEQVIALKAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0318567_100515121 | 3300031821 | Soil | GEINLKGMEQVIALMAEGETIKPPLPAAERFVDLQYLHAAGVQ |
| Ga0318517_100099613 | 3300031835 | Soil | MEQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ |
| Ga0306919_106562831 | 3300031879 | Soil | NGLEQVIAMMAEARTINPPLPSAERFVDLQYLRAAGVQ |
| Ga0310916_106437422 | 3300031942 | Soil | GLEQVIAFMGEAGNLKPPLPPAERFVELQYLHAAGVK |
| Ga0310910_107798671 | 3300031946 | Soil | LKGMEQVIALMGESETIKAPLPAAERFVDLQYLHAAGVQ |
| Ga0318518_104566862 | 3300032090 | Soil | EQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ |
| Ga0318519_100142153 | 3300033290 | Soil | NLKGMEQVIALMGESETIKAPLPVAERFVDLQYLHAAGVQ |
| Ga0372943_0113994_33_143 | 3300034268 | Soil | LDQVIAFMGEGGALPAPLPPAARFVDLQYLRAAGVE |
| ⦗Top⦘ |