


| Basic Information | |
|---|---|
| Family ID | F101500 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.59 % |
| % of genes near scaffold ends (potentially truncated) | 31.37 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.725 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.647 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.216 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.078 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF06742 | DUF1214 | 46.08 |
| PF00905 | Transpeptidase | 14.71 |
| PF00912 | Transgly | 0.98 |
| PF06863 | DUF1254 | 0.98 |
| PF02657 | SufE | 0.98 |
| PF04610 | TrbL | 0.98 |
| PF00126 | HTH_1 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 47.06 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 46.08 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG3704 | Type IV secretory pathway, VirB6 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
| COG3846 | Type IV secretory pathway, TrbL components | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.73 % |
| Unclassified | root | N/A | 36.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10045188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1327 | Open in IMG/M |
| 3300002092|JGI24218J26658_1000006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 604817 | Open in IMG/M |
| 3300005166|Ga0066674_10159807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1066 | Open in IMG/M |
| 3300005355|Ga0070671_101432709 | Not Available | 611 | Open in IMG/M |
| 3300005444|Ga0070694_101904580 | Not Available | 508 | Open in IMG/M |
| 3300005455|Ga0070663_100385468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1142 | Open in IMG/M |
| 3300005455|Ga0070663_100699182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 861 | Open in IMG/M |
| 3300005466|Ga0070685_10442634 | Not Available | 909 | Open in IMG/M |
| 3300005471|Ga0070698_100595786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1045 | Open in IMG/M |
| 3300005471|Ga0070698_101580895 | Not Available | 607 | Open in IMG/M |
| 3300005543|Ga0070672_100487069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1065 | Open in IMG/M |
| 3300005548|Ga0070665_101160441 | Not Available | 783 | Open in IMG/M |
| 3300005553|Ga0066695_10083197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1946 | Open in IMG/M |
| 3300005557|Ga0066704_10161584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1505 | Open in IMG/M |
| 3300005561|Ga0066699_10498430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 871 | Open in IMG/M |
| 3300005564|Ga0070664_102182025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 526 | Open in IMG/M |
| 3300005841|Ga0068863_102530239 | Not Available | 522 | Open in IMG/M |
| 3300005844|Ga0068862_101477090 | Not Available | 685 | Open in IMG/M |
| 3300006031|Ga0066651_10389188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 745 | Open in IMG/M |
| 3300006032|Ga0066696_10250910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1143 | Open in IMG/M |
| 3300006042|Ga0075368_10484699 | Not Available | 551 | Open in IMG/M |
| 3300006046|Ga0066652_101122623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 745 | Open in IMG/M |
| 3300006058|Ga0075432_10502086 | Not Available | 541 | Open in IMG/M |
| 3300006186|Ga0075369_10480418 | Not Available | 590 | Open in IMG/M |
| 3300006353|Ga0075370_10534395 | Not Available | 709 | Open in IMG/M |
| 3300006353|Ga0075370_10641083 | Not Available | 645 | Open in IMG/M |
| 3300006603|Ga0074064_10008279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 864 | Open in IMG/M |
| 3300006852|Ga0075433_11786367 | Not Available | 529 | Open in IMG/M |
| 3300006871|Ga0075434_101078604 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300006954|Ga0079219_11751641 | Not Available | 578 | Open in IMG/M |
| 3300009092|Ga0105250_10331539 | Not Available | 663 | Open in IMG/M |
| 3300009100|Ga0075418_12176209 | Not Available | 605 | Open in IMG/M |
| 3300009148|Ga0105243_12781801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 530 | Open in IMG/M |
| 3300009174|Ga0105241_10334582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1310 | Open in IMG/M |
| 3300009545|Ga0105237_11692410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 640 | Open in IMG/M |
| 3300009802|Ga0105073_1010714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 828 | Open in IMG/M |
| 3300010303|Ga0134082_10507753 | Not Available | 527 | Open in IMG/M |
| 3300010400|Ga0134122_11336165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 727 | Open in IMG/M |
| 3300011429|Ga0137455_1036898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1360 | Open in IMG/M |
| 3300012198|Ga0137364_10472769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 941 | Open in IMG/M |
| 3300012360|Ga0137375_10186473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1981 | Open in IMG/M |
| 3300012501|Ga0157351_1045832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300012685|Ga0137397_10052734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2922 | Open in IMG/M |
| 3300012901|Ga0157288_10143364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 704 | Open in IMG/M |
| 3300012924|Ga0137413_11337214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 576 | Open in IMG/M |
| 3300012938|Ga0162651_100078526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 549 | Open in IMG/M |
| 3300012951|Ga0164300_10092649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1308 | Open in IMG/M |
| 3300012985|Ga0164308_11845403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 563 | Open in IMG/M |
| 3300012988|Ga0164306_10216217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1354 | Open in IMG/M |
| 3300012989|Ga0164305_10122148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1717 | Open in IMG/M |
| 3300014166|Ga0134079_10254132 | Not Available | 761 | Open in IMG/M |
| 3300014317|Ga0075343_1163094 | Not Available | 558 | Open in IMG/M |
| 3300014325|Ga0163163_12343668 | Not Available | 592 | Open in IMG/M |
| 3300014745|Ga0157377_10309958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1045 | Open in IMG/M |
| 3300014969|Ga0157376_11328382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 749 | Open in IMG/M |
| 3300015200|Ga0173480_10400308 | Not Available | 797 | Open in IMG/M |
| 3300015264|Ga0137403_10695353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 877 | Open in IMG/M |
| 3300017657|Ga0134074_1378190 | Not Available | 525 | Open in IMG/M |
| 3300018027|Ga0184605_10143875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1070 | Open in IMG/M |
| 3300018028|Ga0184608_10207645 | Not Available | 858 | Open in IMG/M |
| 3300018051|Ga0184620_10108001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 865 | Open in IMG/M |
| 3300018052|Ga0184638_1245591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 618 | Open in IMG/M |
| 3300018053|Ga0184626_10148783 | Not Available | 996 | Open in IMG/M |
| 3300018072|Ga0184635_10156073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 911 | Open in IMG/M |
| 3300018075|Ga0184632_10342668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 641 | Open in IMG/M |
| 3300018431|Ga0066655_10505803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 801 | Open in IMG/M |
| 3300018465|Ga0190269_10213670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 1056 | Open in IMG/M |
| 3300018469|Ga0190270_10098865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2228 | Open in IMG/M |
| 3300018469|Ga0190270_11398384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 746 | Open in IMG/M |
| 3300018469|Ga0190270_12689722 | Not Available | 560 | Open in IMG/M |
| 3300019361|Ga0173482_10274284 | Not Available | 729 | Open in IMG/M |
| 3300019377|Ga0190264_10916835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 687 | Open in IMG/M |
| 3300019873|Ga0193700_1059189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 589 | Open in IMG/M |
| 3300025899|Ga0207642_10365979 | Not Available | 854 | Open in IMG/M |
| 3300025940|Ga0207691_11021734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 689 | Open in IMG/M |
| 3300025945|Ga0207679_11119644 | Not Available | 722 | Open in IMG/M |
| 3300025981|Ga0207640_11148656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 689 | Open in IMG/M |
| 3300026067|Ga0207678_11280594 | Not Available | 649 | Open in IMG/M |
| 3300026318|Ga0209471_1154990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 942 | Open in IMG/M |
| 3300026334|Ga0209377_1156985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 851 | Open in IMG/M |
| 3300026542|Ga0209805_1065302 | Not Available | 1782 | Open in IMG/M |
| 3300027880|Ga0209481_10433196 | Not Available | 676 | Open in IMG/M |
| 3300028379|Ga0268266_10266976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
| 3300028380|Ga0268265_11445053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 690 | Open in IMG/M |
| 3300028786|Ga0307517_10393358 | Not Available | 736 | Open in IMG/M |
| 3300028802|Ga0307503_10644166 | Not Available | 589 | Open in IMG/M |
| 3300028803|Ga0307281_10033108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1561 | Open in IMG/M |
| 3300031094|Ga0308199_1103814 | Not Available | 629 | Open in IMG/M |
| 3300031184|Ga0307499_10000402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 15511 | Open in IMG/M |
| 3300031184|Ga0307499_10114251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 755 | Open in IMG/M |
| 3300031548|Ga0307408_100278334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1392 | Open in IMG/M |
| 3300031548|Ga0307408_100587170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 988 | Open in IMG/M |
| 3300031901|Ga0307406_11138642 | Not Available | 675 | Open in IMG/M |
| 3300031908|Ga0310900_10244660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri | 1288 | Open in IMG/M |
| 3300031943|Ga0310885_10897688 | Not Available | 508 | Open in IMG/M |
| 3300032005|Ga0307411_10468892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1058 | Open in IMG/M |
| 3300032126|Ga0307415_100177603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1667 | Open in IMG/M |
| 3300033179|Ga0307507_10431434 | Not Available | 736 | Open in IMG/M |
| 3300033180|Ga0307510_10068711 | All Organisms → cellular organisms → Bacteria | 3553 | Open in IMG/M |
| 3300034127|Ga0370489_0011837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2319 | Open in IMG/M |
| 3300034127|Ga0370489_0034098 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300034417|Ga0364941_204996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.90% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.98% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
| 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_100451883 | 3300001305 | Soil | MIRQNLDRLSSERMRGVDAGTRDQKKSLQVLDQAA* |
| JGI24218J26658_1000006564 | 3300002092 | Lentic | MIRQNLDRLSPERMRGVDAGMPNQKEALQLSDEAGPTGI* |
| Ga0066674_101598073 | 3300005166 | Soil | MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI* |
| Ga0070671_1014327091 | 3300005355 | Switchgrass Rhizosphere | CTGAAEELKDMIRQNLDRLSSGRMRGVDAGTRDQKKSLQVLDQAV* |
| Ga0070694_1019045801 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TGAAEELKGMIRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI* |
| Ga0070663_1003854682 | 3300005455 | Corn Rhizosphere | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPAGI* |
| Ga0070663_1006991823 | 3300005455 | Corn Rhizosphere | ELKGMIRQNVNRLSSERMRGVCADMLKPKEALQVSDEAGSTGI* |
| Ga0070685_104426342 | 3300005466 | Switchgrass Rhizosphere | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI* |
| Ga0070698_1005957862 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRQNVNRLSSEQMRGVCTDMLNQKEALQVSDEAGSTGI* |
| Ga0070698_1015808952 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GAAEELKGMIRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI* |
| Ga0070672_1004870693 | 3300005543 | Miscanthus Rhizosphere | MIRQNLNRLSSERMRGVDAGMPNQKEVLQLSDEAGPTGI* |
| Ga0070665_1011604412 | 3300005548 | Switchgrass Rhizosphere | MIRQNLDRLSSERMRGVDAGMRDQKKSLQVLDQAV* |
| Ga0066695_100831971 | 3300005553 | Soil | IRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI* |
| Ga0066704_101615841 | 3300005557 | Soil | IRQNVNRLSSEQMRGVCAVMLTQKEALQVSDEAGSNGI* |
| Ga0066699_104984301 | 3300005561 | Soil | AEELKGMIRHNVNRLSSEQMRSVCTDMPKQKEALQVSDETGSTGI* |
| Ga0070664_1021820252 | 3300005564 | Corn Rhizosphere | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEPGPTGI* |
| Ga0068863_1025302392 | 3300005841 | Switchgrass Rhizosphere | AAEELKGMIRQNVVRLSSERMRGVCAAMPKPKETLQVSDEAGSTGI* |
| Ga0068862_1014770901 | 3300005844 | Switchgrass Rhizosphere | MIRQNVNRLSSEQMRGVRAGMLKPKEALLVSDEAGSTGI* |
| Ga0066651_103891882 | 3300006031 | Soil | MIRQNVNLLSAEQMRGVCAGMLKHKEALQVSDEAGSTGI* |
| Ga0066696_102509103 | 3300006032 | Soil | MIRQNVNRLFSEQMRGVCAGMLKPKDALQVSDEAGSSGI* |
| Ga0075368_104846991 | 3300006042 | Populus Endosphere | MIRQNVNRLFSEQMRDVCPELFKPKEALHVSDEAGSTGI |
| Ga0066652_1011226232 | 3300006046 | Soil | MIRQNVVRLSSERMRGICAGMLKAKALQVSDEAGSSGI* |
| Ga0075432_105020862 | 3300006058 | Populus Rhizosphere | MIRQNVVRLSSEQMRGVCAGMPKPDEALQVSNEAGSSG |
| Ga0075369_104804182 | 3300006186 | Populus Endosphere | AEELKGMIRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI* |
| Ga0075370_105343951 | 3300006353 | Populus Endosphere | RQNVNRLFSEQMRDVCSELFKPKEALQVSDEAGSTGI* |
| Ga0075370_106410831 | 3300006353 | Populus Endosphere | MIRQNVNRLFSEQMRDVCPELFKPNEALQVSDEAGSTGI* |
| Ga0074064_100082792 | 3300006603 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGSTGI* |
| Ga0075433_117863672 | 3300006852 | Populus Rhizosphere | GMIRQNVNRLSWERMRGVWPDMLEHKEALQVSDEAGSTGI* |
| Ga0075434_1010786042 | 3300006871 | Populus Rhizosphere | MIRQNVNRLSWERMRGVWPDMLEHKEALQVSDEAGSTGI* |
| Ga0079219_117516411 | 3300006954 | Agricultural Soil | KGMIRQNVVRLSSEQMRGVSAGTLPHREAFQVLDEAGSSGI* |
| Ga0105250_103315391 | 3300009092 | Switchgrass Rhizosphere | NVNRLSSEQMRGVCVGMLTHKEALQVSDEAGSSGI* |
| Ga0075418_121762092 | 3300009100 | Populus Rhizosphere | EELKGMIRQNVNRLSSERMRGVCADMLEHREALQVSDEAGSTGI* |
| Ga0105243_127818012 | 3300009148 | Miscanthus Rhizosphere | MIRQNLNRLSSERMRGVDAGMPNQKEALQLSDEAGPAGI* |
| Ga0105241_103345823 | 3300009174 | Corn Rhizosphere | MIRQNVVRLSSEQMRGVRADLLNQKEALQVSDEAGSTGI* |
| Ga0105237_116924102 | 3300009545 | Corn Rhizosphere | MIRQNVNRLFSEQMRDVCPELFKPKEALQVSDEAGSTGI* |
| Ga0105073_10107141 | 3300009802 | Groundwater Sand | NVNRLSSEQMRGVRAGMITQKEALQVSDEAGSTGI* |
| Ga0134082_105077532 | 3300010303 | Grasslands Soil | GAAEELKGMIRQNVNRLSSEQMRGVCAGMLKQALQVSDEAGSTGI* |
| Ga0134122_113361652 | 3300010400 | Terrestrial Soil | MIRQNVVRLSSEQMQGVRADLLKQKEALQVSDEAGSTGI* |
| Ga0137455_10368983 | 3300011429 | Soil | KGMIRQNVNPLSSEQMRGVRADMPKQKEALQVSDEAGSTGI* |
| Ga0137364_104727692 | 3300012198 | Vadose Zone Soil | MIRQNVNRLSSEEMRGVCAGMLKQALQVSDEAGSTGI* |
| Ga0137375_101864732 | 3300012360 | Vadose Zone Soil | MIRQNVNRLSSEQMRGVRAGMLTQKEALQVSDEAGSTGI* |
| Ga0157351_10458322 | 3300012501 | Unplanted Soil | MIRQNVNRLSSERMRGVCADMPKQKEAFQVSDEAGSTGI* |
| Ga0137397_100527342 | 3300012685 | Vadose Zone Soil | MIRQNVNRLSSEEMRGVRAGMLTQKEALQVSDEAGSTGI* |
| Ga0157288_101433642 | 3300012901 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEVLQLSDEAGPTGI* |
| Ga0137413_113372142 | 3300012924 | Vadose Zone Soil | MIRQNVNLLSSEQMRGVCDGMLTHKEALQVSDEAGSSGI* |
| Ga0162651_1000785262 | 3300012938 | Soil | MIRQNVNRLSSEQMRGVCADMPEQKEALQVSDEAGSTGI* |
| Ga0164300_100926492 | 3300012951 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGSPGI* |
| Ga0164308_118454032 | 3300012985 | Soil | MIRQNLNRLSSERLRGVDAGMPNQKEALQLSDEAGPAGI* |
| Ga0164306_102162172 | 3300012988 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDESGSTGI* |
| Ga0164305_101221482 | 3300012989 | Soil | LKDMIRQNLERMRGVDAGMPNQKEALQLSDEAGSPGI* |
| Ga0134079_102541322 | 3300014166 | Grasslands Soil | MIRQNVNRLSSEEMRGVCAGMLKPKEALQVSDEAGSSGI* |
| Ga0075343_11630942 | 3300014317 | Natural And Restored Wetlands | GMIRQNVNRLSSEQMPAVCAGMLKQKEALQVSDEAGSTGI* |
| Ga0163163_123436682 | 3300014325 | Switchgrass Rhizosphere | GAAEELKGMIRQNVTRLFSEQMRDVCPELFKPKEALQVSDEAGSTGI* |
| Ga0157377_103099582 | 3300014745 | Miscanthus Rhizosphere | MIRQNLNRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI* |
| Ga0157376_113283822 | 3300014969 | Miscanthus Rhizosphere | MIRQNLNRLSSERLRGVDAGMPNQKEALQLSDEAGPTGI* |
| Ga0173480_104003082 | 3300015200 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPSGI* |
| Ga0137403_106953532 | 3300015264 | Vadose Zone Soil | MNRQNVNLLSAEQMRGVCAGMLKPKEALQVSDEAGSTGI* |
| Ga0134074_13781902 | 3300017657 | Grasslands Soil | GMIRQNVNRLSSEEMRGVCAGMLKPKEALQVSDEAGSTGI |
| Ga0184605_101438751 | 3300018027 | Groundwater Sediment | GAAEELKGMIRQNVNRLSSEQMRGVCPGMLKPKEALQVSDEAGSSGI |
| Ga0184608_102076452 | 3300018028 | Groundwater Sediment | MIRQNVNRLSSEQMQGVCADMPEQKEALQVSDEAGSTGI |
| Ga0184620_101080012 | 3300018051 | Groundwater Sediment | MIRQNVNRLSSEQMRGVRADMLTQKEALQVSDEAGSTGI |
| Ga0184638_12455912 | 3300018052 | Groundwater Sediment | MIRQNVNPLSLEQMRGVRADMLKQKEALQVSDEAGSTGI |
| Ga0184626_101487832 | 3300018053 | Groundwater Sediment | MIRQNVNPLSSEQMRGVRADMLKQKEALQVSDEAGSTGI |
| Ga0184635_101560732 | 3300018072 | Groundwater Sediment | MIRQNVNRLSSEQMRGVSADMLKRKEALQVSDEAGSTGI |
| Ga0184632_103426681 | 3300018075 | Groundwater Sediment | AEELKDMIRQNVNPLSLEQMRGVRADMLKQKEALQVSDEAGSTGI |
| Ga0066655_105058032 | 3300018431 | Grasslands Soil | MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGSTGI |
| Ga0190269_102136702 | 3300018465 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI |
| Ga0190270_100988653 | 3300018469 | Soil | MIRQNVNRLSSEQMRGVCADMPQQKEALQVSDEAGSTGI |
| Ga0190270_113983842 | 3300018469 | Soil | MIRQNVNRLSSEQMRGVCAEMPKQKEALQVSDEAGSTGT |
| Ga0190270_126897221 | 3300018469 | Soil | MIRQNLDRLSPERMRGVDAGMPNQKEALQLSDEAGPTGI |
| Ga0173482_102742841 | 3300019361 | Soil | LKRMIRQNVNRLSSERMRGIGFDMLKPKQALQVSDEAGSTGI |
| Ga0190264_109168352 | 3300019377 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSGEAGPTGI |
| Ga0193700_10591892 | 3300019873 | Soil | MIRQNVNRLSSEEMRGVRADMLTQKEALQVSDEAGSTGI |
| Ga0207642_103659792 | 3300025899 | Miscanthus Rhizosphere | MIRQNVNRLFSEQMRDVCSELFKPKEALQVSDEAGSTGI |
| Ga0207691_110217342 | 3300025940 | Miscanthus Rhizosphere | MIRQNLNRLSSERMRGVDAGMPNQKEVLQLSDEAGPTGI |
| Ga0207679_111196442 | 3300025945 | Corn Rhizosphere | MIRQNLDRLSSERMRGVDAGMRDQKKSLQVLDQAV |
| Ga0207640_111486562 | 3300025981 | Corn Rhizosphere | MIRQNVNRLSSERMRGVCADMLKPKEALQVSDEAGSTGI |
| Ga0207678_112805942 | 3300026067 | Corn Rhizosphere | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPAGI |
| Ga0209471_11549902 | 3300026318 | Soil | MIRHNVNRLSSEQMRSVCTDMPKQKEALQISDEIGSTGI |
| Ga0209377_11569852 | 3300026334 | Soil | MIRQNVNRLSSEQMRGVCADMLTQKEALQVSDEAGS |
| Ga0209805_10653021 | 3300026542 | Soil | ELKGMIRHNVNRLSSEQMRSVCTDMPKQKEALQVSDETGSTGI |
| Ga0209481_104331962 | 3300027880 | Populus Rhizosphere | IRQNVNRLSSERMRGVCADMLKQREALQVSDEAGSTGI |
| Ga0268266_102669761 | 3300028379 | Switchgrass Rhizosphere | MIRQNVNRLFSEQMRDVCPELFKPKEALQVSDEAGSTGI |
| Ga0268265_114450532 | 3300028380 | Switchgrass Rhizosphere | MIRQNVNRLSSEQMRGVRAGMLKPKEALLVSDEAGSTGI |
| Ga0307517_103933582 | 3300028786 | Ectomycorrhiza | MIRQNLNRLSSERLRGVDAGMPNQKEALQLSDEAGPAGI |
| Ga0307503_106441661 | 3300028802 | Soil | MIRQNLNRLSSERMRGVDAGMPNQKVALQLSDEAGPTGI |
| Ga0307281_100331083 | 3300028803 | Soil | MIRQNVNPLSSEQMRGVRADMLRQKEALQVSDEAGSTGI |
| Ga0308199_11038141 | 3300031094 | Soil | MIRQNVNRLSSEQMRGVRADLLKQKEALQVSDEAGSTGI |
| Ga0307499_100004022 | 3300031184 | Soil | MIRQNLDRLSSERMRGADAGMPNQKEALQLSDEAGPTGI |
| Ga0307499_101142512 | 3300031184 | Soil | MIRQNVNRLSSEQMRGVRADMLTQKEAIQVSDEAGSTGI |
| Ga0307408_1002783342 | 3300031548 | Rhizosphere | MIRQNLDRLSSERMGGVDAGMPNQKEALQLSDEAGPTGI |
| Ga0307408_1005871701 | 3300031548 | Rhizosphere | MIRQNVNRLSSEWMRGVCRDMLARNDALQVPDEAGSSGI |
| Ga0307406_111386421 | 3300031901 | Rhizosphere | MIRQNVNRLSSEWMRGVCRDMLARNDALQVPDEAGS |
| Ga0310900_102446602 | 3300031908 | Soil | MIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGSTGI |
| Ga0310885_108976881 | 3300031943 | Soil | TGAAEELKAMIRQNLDRLSSERMRGVDAGMPNQKEALQLSDEAGPTGI |
| Ga0307411_104688921 | 3300032005 | Rhizosphere | MIRQNVNRLSSEWMRGVCRDMLARNDAVQVPDEAGS |
| Ga0307415_1001776033 | 3300032126 | Rhizosphere | MIRQNLDRLSSERMRGADAGMLNQKEALQLSDEAGPTGI |
| Ga0307507_104314342 | 3300033179 | Ectomycorrhiza | MIRQNVNRLSSEQMRGVRADMLTQKEAVQVSDEAGSTGI |
| Ga0307510_100687114 | 3300033180 | Ectomycorrhiza | MIRQNVNLLSAEQMRGVCAGMLKHKQALQVSDEAGSTGI |
| Ga0370489_0011837_984_1103 | 3300034127 | Untreated Peat Soil | MIRQNVDPLSSEQMRGARAGMLKQKEALQVSDEAGSTGI |
| Ga0370489_0034098_533_652 | 3300034127 | Untreated Peat Soil | MIRQNLERLSSEPMRGVDAGMPDHQEALQVSDEAGSTGV |
| Ga0364941_204996_162_281 | 3300034417 | Sediment | MIRQNVNRLSSEEMRGVCAGMLTHKEALQVSFEAGSTGI |
| ⦗Top⦘ |