


| Basic Information | |
|---|---|
| Family ID | F101470 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 39 residues |
| Representative Sequence | DILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.76 % |
| % of genes near scaffold ends (potentially truncated) | 80.39 % |
| % of genes from short scaffolds (< 2000 bps) | 76.47 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.745 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.647 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 10.94% β-sheet: 0.00% Coil/Unstructured: 89.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 16.67 |
| PF03401 | TctC | 5.88 |
| PF13575 | DUF4135 | 5.88 |
| PF02353 | CMAS | 3.92 |
| PF00111 | Fer2 | 1.96 |
| PF04392 | ABC_sub_bind | 0.98 |
| PF00365 | PFK | 0.98 |
| PF13472 | Lipase_GDSL_2 | 0.98 |
| PF06100 | MCRA | 0.98 |
| PF01656 | CbiA | 0.98 |
| PF00027 | cNMP_binding | 0.98 |
| PF07015 | VirC1 | 0.98 |
| PF05147 | LANC_like | 0.98 |
| PF00378 | ECH_1 | 0.98 |
| PF06035 | Peptidase_C93 | 0.98 |
| PF09361 | Phasin_2 | 0.98 |
| PF11941 | DUF3459 | 0.98 |
| PF03713 | DUF305 | 0.98 |
| PF00166 | Cpn10 | 0.98 |
| PF05099 | TerB | 0.98 |
| PF05128 | DUF697 | 0.98 |
| PF00202 | Aminotran_3 | 0.98 |
| PF01207 | Dus | 0.98 |
| PF00083 | Sugar_tr | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 5.88 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 3.92 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 3.92 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 3.92 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.98 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.98 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.98 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.98 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.98 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.98 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.98 |
| COG4716 | Myosin-crossreactive antigen (function unknown) | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.75 % |
| Unclassified | root | N/A | 37.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01B1KFW | Not Available | 518 | Open in IMG/M |
| 2162886007|SwRhRL2b_contig_1088114 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300000043|ARcpr5yngRDRAFT_c003141 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300000156|NODE_c0718518 | All Organisms → cellular organisms → Bacteria | 5565 | Open in IMG/M |
| 3300003994|Ga0055435_10176022 | Not Available | 607 | Open in IMG/M |
| 3300004062|Ga0055500_10139133 | Not Available | 568 | Open in IMG/M |
| 3300004463|Ga0063356_103235179 | Not Available | 702 | Open in IMG/M |
| 3300004463|Ga0063356_105668017 | Not Available | 536 | Open in IMG/M |
| 3300005334|Ga0068869_100651698 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005468|Ga0070707_102084868 | Not Available | 535 | Open in IMG/M |
| 3300005529|Ga0070741_10001995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 57329 | Open in IMG/M |
| 3300005564|Ga0070664_100865413 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300005607|Ga0070740_10298616 | Not Available | 645 | Open in IMG/M |
| 3300005618|Ga0068864_100687984 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005713|Ga0066905_100064155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2327 | Open in IMG/M |
| 3300006050|Ga0075028_100750243 | Not Available | 591 | Open in IMG/M |
| 3300006196|Ga0075422_10001133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7415 | Open in IMG/M |
| 3300006196|Ga0075422_10073684 | Not Available | 1274 | Open in IMG/M |
| 3300006755|Ga0079222_10024987 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
| 3300006854|Ga0075425_101646946 | Not Available | 722 | Open in IMG/M |
| 3300009098|Ga0105245_10015837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6569 | Open in IMG/M |
| 3300009156|Ga0111538_10346428 | Not Available | 1880 | Open in IMG/M |
| 3300009174|Ga0105241_10904829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta | 820 | Open in IMG/M |
| 3300010043|Ga0126380_10054423 | Not Available | 2182 | Open in IMG/M |
| 3300010043|Ga0126380_10918421 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 729 | Open in IMG/M |
| 3300010358|Ga0126370_10097984 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300010358|Ga0126370_10130991 | Not Available | 1795 | Open in IMG/M |
| 3300010358|Ga0126370_11329262 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 675 | Open in IMG/M |
| 3300010358|Ga0126370_11592461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 625 | Open in IMG/M |
| 3300010359|Ga0126376_10159112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1820 | Open in IMG/M |
| 3300010361|Ga0126378_11560950 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010371|Ga0134125_10235957 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300010371|Ga0134125_11388544 | Not Available | 766 | Open in IMG/M |
| 3300010373|Ga0134128_12835377 | Not Available | 534 | Open in IMG/M |
| 3300010376|Ga0126381_101153394 | Not Available | 1120 | Open in IMG/M |
| 3300010376|Ga0126381_101780786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 889 | Open in IMG/M |
| 3300010376|Ga0126381_104512284 | Not Available | 537 | Open in IMG/M |
| 3300010396|Ga0134126_11573618 | Not Available | 723 | Open in IMG/M |
| 3300012487|Ga0157321_1015438 | Not Available | 645 | Open in IMG/M |
| 3300012501|Ga0157351_1015801 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300012906|Ga0157295_10116337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300012908|Ga0157286_10044140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1113 | Open in IMG/M |
| 3300012913|Ga0157298_10004189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2066 | Open in IMG/M |
| 3300012955|Ga0164298_11459001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300012971|Ga0126369_10075596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2970 | Open in IMG/M |
| 3300013100|Ga0157373_10106558 | Not Available | 1971 | Open in IMG/M |
| 3300015245|Ga0137409_11524223 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300015371|Ga0132258_13223161 | Not Available | 1125 | Open in IMG/M |
| 3300015372|Ga0132256_101170424 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300015374|Ga0132255_100347085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2149 | Open in IMG/M |
| 3300015374|Ga0132255_103007354 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300017927|Ga0187824_10111575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300017944|Ga0187786_10126544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300017944|Ga0187786_10319691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300017959|Ga0187779_10005360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 7562 | Open in IMG/M |
| 3300017961|Ga0187778_10035130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3065 | Open in IMG/M |
| 3300018060|Ga0187765_10038668 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300019356|Ga0173481_10000119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13856 | Open in IMG/M |
| 3300021445|Ga0182009_10340007 | Not Available | 764 | Open in IMG/M |
| 3300022737|Ga0247747_1001034 | Not Available | 2841 | Open in IMG/M |
| 3300022883|Ga0247786_1133156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300023062|Ga0247791_1046583 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300025321|Ga0207656_10564186 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025538|Ga0210132_1004641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1760 | Open in IMG/M |
| 3300025558|Ga0210139_1077371 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300025878|Ga0209584_10322087 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025900|Ga0207710_10063134 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300025941|Ga0207711_10385106 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300025986|Ga0207658_10036166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3540 | Open in IMG/M |
| 3300026041|Ga0207639_10509738 | Not Available | 1100 | Open in IMG/M |
| 3300026142|Ga0207698_10685482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1018 | Open in IMG/M |
| 3300026223|Ga0209840_1075257 | Not Available | 740 | Open in IMG/M |
| 3300026741|Ga0207510_102747 | Not Available | 603 | Open in IMG/M |
| 3300026960|Ga0207582_1006584 | Not Available | 996 | Open in IMG/M |
| 3300027403|Ga0207609_104055 | Not Available | 544 | Open in IMG/M |
| 3300027552|Ga0209982_1054984 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300027560|Ga0207981_1022835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1130 | Open in IMG/M |
| 3300027706|Ga0209581_1015269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4361 | Open in IMG/M |
| 3300027874|Ga0209465_10235385 | Not Available | 915 | Open in IMG/M |
| 3300027898|Ga0209067_10329548 | Not Available | 844 | Open in IMG/M |
| 3300027907|Ga0207428_10928246 | Not Available | 614 | Open in IMG/M |
| 3300028720|Ga0307317_10155155 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300028784|Ga0307282_10469789 | Not Available | 610 | Open in IMG/M |
| 3300028885|Ga0307304_10624381 | Not Available | 500 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1000736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5432 | Open in IMG/M |
| 3300031170|Ga0307498_10018295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1553 | Open in IMG/M |
| 3300031653|Ga0315550_1021422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3346 | Open in IMG/M |
| 3300031744|Ga0306918_11035423 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031896|Ga0318551_10248725 | Not Available | 993 | Open in IMG/M |
| 3300031913|Ga0310891_10006558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2539 | Open in IMG/M |
| 3300031938|Ga0308175_101829725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300032003|Ga0310897_10064956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1360 | Open in IMG/M |
| 3300032013|Ga0310906_10919916 | Not Available | 625 | Open in IMG/M |
| 3300032075|Ga0310890_10152105 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300032174|Ga0307470_10554428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 850 | Open in IMG/M |
| 3300032205|Ga0307472_100075138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2222 | Open in IMG/M |
| 3300032205|Ga0307472_100436445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
| 3300033433|Ga0326726_11159439 | Not Available | 751 | Open in IMG/M |
| 3300033500|Ga0326730_1052509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 783 | Open in IMG/M |
| 3300033551|Ga0247830_11661275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300034090|Ga0326723_0235711 | Not Available | 814 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026741 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-C (SPAdes) | Environmental | Open in IMG/M |
| 3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027403 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031653 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_1065030 | 2040502001 | Soil | EDLLTYEVSDEALETVGGKEIAGNYTLGACTGLSVCDG |
| SwRhRL2b_0537.00001480 | 2162886007 | Switchgrass Rhizosphere | DILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| ARcpr5yngRDRAFT_0031413 | 3300000043 | Arabidopsis Rhizosphere | MTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| NODE_07185186 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTNQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0055435_101760221 | 3300003994 | Natural And Restored Wetlands | MTTQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0055500_101391332 | 3300004062 | Natural And Restored Wetlands | DGEVLAFEVSDAALEIAAASAKEKANFTLGACSGLSVCPG* |
| Ga0063356_1032351791 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0063356_1056680171 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCP |
| Ga0068869_1006516981 | 3300005334 | Miscanthus Rhizosphere | MTNEEDIPAFEVSDEALEAAAGSEQVNYTLGACTGLSVCP |
| Ga0070707_1020848681 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0070741_1000199540 | 3300005529 | Surface Soil | MKTMFEQIEEEILAFDVSDDALEVAAGGKEQASYTLGACTGLSVCPG* |
| Ga0070664_1008654131 | 3300005564 | Corn Rhizosphere | QEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0070740_102986161 | 3300005607 | Surface Soil | MNETMIAEQEILSFEVSDEALEVTAGSEKEYASYTLGACTGLSVCPQ* |
| Ga0068864_1006879842 | 3300005618 | Switchgrass Rhizosphere | LAIEVADVALEIAAGTAKEKANFTLGACTGLSECPG* |
| Ga0066905_1000641552 | 3300005713 | Tropical Forest Soil | MQILGFEVSDEALESAGDSAKKANFTLGACTGLSVCDG* |
| Ga0075028_1007502431 | 3300006050 | Watersheds | NVTFEVTDEALELAAGAAKEKANFTLGACTGLSVCDG* |
| Ga0075422_100011338 | 3300006196 | Populus Rhizosphere | VTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0075422_100736841 | 3300006196 | Populus Rhizosphere | HREELVIDTVSDGAEIAAGAAKEQANFTLCTCSGLSVCPG* |
| Ga0079222_100249875 | 3300006755 | Agricultural Soil | NNVSDEALEIAAGSAKEKANFTLGACSGLSVCPG* |
| Ga0075425_1016469461 | 3300006854 | Populus Rhizosphere | EILAFEVADVALEIAAGTAGKANFTLGACTGLSECPG* |
| Ga0105245_100158374 | 3300009098 | Miscanthus Rhizosphere | MTKQEDVLAFEVSDEALEAAAGGEQVNYTLGACTGLSVCPG* |
| Ga0111538_103464281 | 3300009156 | Populus Rhizosphere | GIVTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0105241_109048292 | 3300009174 | Corn Rhizosphere | FKVSDEALEIAAGAAQEKANFTLGACTGLSECPG* |
| Ga0126380_100544231 | 3300010043 | Tropical Forest Soil | ETLAFNVSDEVLEIAAGSAKEKANFTLGACTGLSECPG* |
| Ga0126380_109184211 | 3300010043 | Tropical Forest Soil | AFEVSDEALEIAAGTSKEKANFTLGACSGLSVCPG* |
| Ga0126370_100979844 | 3300010358 | Tropical Forest Soil | LAFNVSDEVLEIAAGTAKEKANFTLGACTGLSECPG* |
| Ga0126370_101309911 | 3300010358 | Tropical Forest Soil | EELFINLISDEALEIAAGSTKEKANFTLGACSGLSVCPG* |
| Ga0126370_113292621 | 3300010358 | Tropical Forest Soil | KEILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG* |
| Ga0126370_115924612 | 3300010358 | Tropical Forest Soil | LIYEVSDEALEIAAGTTREPVNFTLGSCTGLSECPG* |
| Ga0126376_101591124 | 3300010359 | Tropical Forest Soil | GFEVSDEALESAGDSAKKANFTLGACTGLSVCDG* |
| Ga0126378_115609502 | 3300010361 | Tropical Forest Soil | DFEIADEALEIASGVANAPANFTLGACTGLSECPG* |
| Ga0134125_102359572 | 3300010371 | Terrestrial Soil | LPNKEEILAFEVSDEALEAAAGNEQVNYTLGACSGLSVCPG* |
| Ga0134125_113885441 | 3300010371 | Terrestrial Soil | EVLAFDVSDEALENAAGSETQAFTLGACSGLSVCPG* |
| Ga0134128_128353771 | 3300010373 | Terrestrial Soil | LAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0126381_1011533941 | 3300010376 | Tropical Forest Soil | KEILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCEG* |
| Ga0126381_1017807863 | 3300010376 | Tropical Forest Soil | EDEILAFEISDAALETAAGVAKDKANFTLGACTGLSECPG* |
| Ga0126381_1045122843 | 3300010376 | Tropical Forest Soil | LGFEVSDAALESAAGNAKGKANFTLGACTGLSVCGG* |
| Ga0134126_115736181 | 3300010396 | Terrestrial Soil | MTNEEDILAFEVSDEALEAAAGNEQVNYTLGACSGLSVCPG* |
| Ga0157321_10154381 | 3300012487 | Arabidopsis Rhizosphere | EELFINNVSDEALEIAAGSAKEKANFTLGACSGLSVCPG* |
| Ga0157351_10158012 | 3300012501 | Unplanted Soil | YAMTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0157295_101163371 | 3300012906 | Soil | IFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG* |
| Ga0157286_100441402 | 3300012908 | Soil | TKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0157298_100041891 | 3300012913 | Soil | ILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0153915_104735361 | 3300012931 | Freshwater Wetlands | MQNTATNLEKAEQLVVAFDVSDEALEMAAGAAKEKANFTLGACSGL |
| Ga0164298_114590011 | 3300012955 | Soil | DIFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG* |
| Ga0126369_100755964 | 3300012971 | Tropical Forest Soil | AFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG* |
| Ga0157373_101065581 | 3300013100 | Corn Rhizosphere | RNYAMTNQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0137409_115242231 | 3300015245 | Vadose Zone Soil | AFEVSDEALESAAGTAKEKANFTLGACSGLSVCGG* |
| Ga0132258_132231611 | 3300015371 | Arabidopsis Rhizosphere | QEILAFEVADVALEIAAGTAKGKANFTLGACTGLSECPG* |
| Ga0132256_1011704242 | 3300015372 | Arabidopsis Rhizosphere | SGISDEALEIAAGTAKEKANFTLGACSGLSVCPG* |
| Ga0132255_1003470853 | 3300015374 | Arabidopsis Rhizosphere | DGILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG* |
| Ga0132255_1030073542 | 3300015374 | Arabidopsis Rhizosphere | IVTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG* |
| Ga0187824_101115751 | 3300017927 | Freshwater Sediment | LAFDVSDEALEMAAGSAKEKANFTLGACTGLSVCDG |
| Ga0187786_101265442 | 3300017944 | Tropical Peatland | EILAFEVSDEALESAAGSEKANFTLGACTGLSVCDG |
| Ga0187786_103196912 | 3300017944 | Tropical Peatland | LISGSSDAALEIAAGIAKEKASFTLGACTGLSVCDG |
| Ga0187779_100053601 | 3300017959 | Tropical Peatland | ILAFEVADEALEIAGGKEKAGSFTLGACTGLSVCDG |
| Ga0187778_100351304 | 3300017961 | Tropical Peatland | EILAFEVSDEALEIAAGSEKANFTLGACTGLSVCDG |
| Ga0187765_100386681 | 3300018060 | Tropical Peatland | EIFGSEVSDAALESAAGTAKDKANFTLGACTGLSVCGG |
| Ga0173481_100001194 | 3300019356 | Soil | MTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0182009_103400071 | 3300021445 | Soil | MTNQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0247747_10010342 | 3300022737 | Soil | MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0247786_11331561 | 3300022883 | Soil | DIFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG |
| Ga0247791_10465831 | 3300023062 | Soil | MTKQEDVLAFEVSDEALEAAAGGEQVNYTLGACTGLSVCPG |
| Ga0207656_105641861 | 3300025321 | Corn Rhizosphere | KGIVTMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0210132_10046411 | 3300025538 | Natural And Restored Wetlands | TQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0210139_10773711 | 3300025558 | Natural And Restored Wetlands | MTTQEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0209584_103220872 | 3300025878 | Arctic Peat Soil | FEASDEALEAAAGTGREMAANYTLAACSGLSVCPA |
| Ga0207710_100631343 | 3300025900 | Switchgrass Rhizosphere | MTNQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0207711_103851061 | 3300025941 | Switchgrass Rhizosphere | MTNQEDVLAFEVSDEALEAAAGSEQVNYTLGACTG |
| Ga0207658_100361664 | 3300025986 | Switchgrass Rhizosphere | AMTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0207639_105097381 | 3300026041 | Corn Rhizosphere | EQEMLAFEVADEVLEIASGTAKERANFTLGACTGLSECPG |
| Ga0207698_106854823 | 3300026142 | Corn Rhizosphere | NILTFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0209840_10752572 | 3300026223 | Soil | TLTFEVTDETLEAAAGTVKEKAANYTLAACSGLSVCPA |
| Ga0207510_1027472 | 3300026741 | Soil | EEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0207582_10065841 | 3300026960 | Soil | TKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0207609_1040551 | 3300027403 | Soil | KQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0209982_10549842 | 3300027552 | Arabidopsis Thaliana Rhizosphere | MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSVC |
| Ga0207981_10228351 | 3300027560 | Soil | GILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0209581_10152692 | 3300027706 | Surface Soil | MKTMFEQIEEEILAFDVSDDALEVAAGGKEQASYTLGACTGLSVCPG |
| Ga0209465_102353851 | 3300027874 | Tropical Forest Soil | FINLVSDEALEIAAGSTKEKANFTLGACSGLSVCPG |
| Ga0209067_103295482 | 3300027898 | Watersheds | ILAYDVSDEALEIAAGGKEKAGSYTLGACTGLSVCPG |
| Ga0207428_109282462 | 3300027907 | Populus Rhizosphere | TMTKQEDVLAFEVSDEALEAAAGSEQVNYTLGACTGLSVCPG |
| Ga0307317_101551551 | 3300028720 | Soil | EILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG |
| Ga0307282_104697892 | 3300028784 | Soil | DELFIKLVSDEALEIAAGSVKEKANFTLGACSGLSVCPG |
| Ga0307304_106243812 | 3300028885 | Soil | AFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG |
| (restricted) Ga0255311_10007362 | 3300031150 | Sandy Soil | MTNEEDILAFEVSDEALEAAAGSEQLNYTLGACTGLSVCPG |
| Ga0307498_100182951 | 3300031170 | Soil | AFEVSDEALEIAAGSTKEKANFTLGACSGLSVCPG |
| Ga0315550_10214221 | 3300031653 | Salt Marsh Sediment | FEVSDEALEAAACMMEDKAANYTLGACSGLSVCPGW |
| Ga0306918_110354232 | 3300031744 | Soil | LSFDVSDEALEISAGLGKENANFTLGACTGLSECPA |
| Ga0318551_102487252 | 3300031896 | Soil | LAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCEG |
| Ga0310891_100065581 | 3300031913 | Soil | ILAFEVSDEALEIAAGMAKEKAGFTLGACTGLSVCDG |
| Ga0308175_1018297252 | 3300031938 | Soil | VMLEKAEEAVLAFEVSDEALEMAAGGALEKANFTLGACSGLSVCDG |
| Ga0310897_100649561 | 3300032003 | Soil | DSILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0310906_109199161 | 3300032013 | Soil | LAFEVADVALEIAAGTAKGKANFTLGACTGLSECPG |
| Ga0310890_101521051 | 3300032075 | Soil | MTNEEDILAFEVSDEALEAAAGSEQVNYTLGACTGLSV |
| Ga0307470_105544281 | 3300032174 | Hardwood Forest Soil | SILNFNVSDEALESAGDNAVAANYTLGACTGLSVCPG |
| Ga0307472_1000751381 | 3300032205 | Hardwood Forest Soil | EEELFINNVSDEALEIAAGSAKEKANFTLGACSGLSVCPG |
| Ga0307472_1004364452 | 3300032205 | Hardwood Forest Soil | EDLFVFEISDDALEAAAGTRNEKAMNFTLGACSGLSECPG |
| Ga0326726_111594392 | 3300033433 | Peat Soil | DLLIFEISDDVLETAAGTRNEKAVNFTLGACSGLSVCPG |
| Ga0326730_10525091 | 3300033500 | Peat Soil | ILVFKVSDEALEIAAGSAKDKANFTLGACTGLSECPG |
| Ga0247830_116612752 | 3300033551 | Soil | IFAFEVSDEALEIAAGTENEKASYTLGACSGLSVCPG |
| Ga0326723_0235711_697_813 | 3300034090 | Peat Soil | EVLAFEVSDAALEIAAASAKEKANFTLGACSGLSVCPG |
| ⦗Top⦘ |