


| Basic Information | |
|---|---|
| Family ID | F101453 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAHGARQRAAADEHDTA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 91.18 % |
| % of genes from short scaffolds (< 2000 bps) | 96.08 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.529 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (39.216 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.020 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.882 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF03358 | FMN_red | 0.98 |
| PF13546 | DDE_5 | 0.98 |
| PF13340 | DUF4096 | 0.98 |
| PF00076 | RRM_1 | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.53 % |
| All Organisms | root | All Organisms | 26.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005167|Ga0066672_10329184 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 996 | Open in IMG/M |
| 3300005171|Ga0066677_10161356 | Not Available | 1234 | Open in IMG/M |
| 3300005295|Ga0065707_10430456 | Not Available | 821 | Open in IMG/M |
| 3300005552|Ga0066701_10691372 | Not Available | 613 | Open in IMG/M |
| 3300005559|Ga0066700_10915262 | Not Available | 582 | Open in IMG/M |
| 3300005844|Ga0068862_102613573 | Not Available | 517 | Open in IMG/M |
| 3300006032|Ga0066696_11051941 | Not Available | 518 | Open in IMG/M |
| 3300006196|Ga0075422_10308109 | Not Available | 680 | Open in IMG/M |
| 3300006796|Ga0066665_10979232 | Not Available | 650 | Open in IMG/M |
| 3300006844|Ga0075428_100480599 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1330 | Open in IMG/M |
| 3300007255|Ga0099791_10083016 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1462 | Open in IMG/M |
| 3300009012|Ga0066710_103280020 | Not Available | 619 | Open in IMG/M |
| 3300009090|Ga0099827_11586680 | Not Available | 570 | Open in IMG/M |
| 3300009094|Ga0111539_10843680 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1066 | Open in IMG/M |
| 3300010038|Ga0126315_10105737 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1620 | Open in IMG/M |
| 3300010081|Ga0127457_1045590 | Not Available | 1833 | Open in IMG/M |
| 3300010089|Ga0127454_1023533 | Not Available | 655 | Open in IMG/M |
| 3300010092|Ga0127468_1079360 | Not Available | 722 | Open in IMG/M |
| 3300010101|Ga0127481_1131717 | Not Available | 514 | Open in IMG/M |
| 3300010102|Ga0127453_1083214 | Not Available | 866 | Open in IMG/M |
| 3300010103|Ga0127500_1041907 | Not Available | 807 | Open in IMG/M |
| 3300010106|Ga0127472_1074686 | Not Available | 1196 | Open in IMG/M |
| 3300010141|Ga0127499_1097047 | Not Available | 1090 | Open in IMG/M |
| 3300010323|Ga0134086_10145635 | Not Available | 862 | Open in IMG/M |
| 3300010323|Ga0134086_10227910 | Not Available | 703 | Open in IMG/M |
| 3300010326|Ga0134065_10482632 | Not Available | 513 | Open in IMG/M |
| 3300010335|Ga0134063_10438678 | Not Available | 645 | Open in IMG/M |
| 3300010366|Ga0126379_11923131 | Not Available | 695 | Open in IMG/M |
| 3300010373|Ga0134128_13119437 | Not Available | 509 | Open in IMG/M |
| 3300010398|Ga0126383_11264561 | Not Available | 828 | Open in IMG/M |
| 3300011271|Ga0137393_10894526 | Not Available | 758 | Open in IMG/M |
| 3300012199|Ga0137383_10670198 | Not Available | 758 | Open in IMG/M |
| 3300012207|Ga0137381_10110981 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300012209|Ga0137379_10164771 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 2128 | Open in IMG/M |
| 3300012224|Ga0134028_1266945 | Not Available | 653 | Open in IMG/M |
| 3300012349|Ga0137387_11320337 | Not Available | 504 | Open in IMG/M |
| 3300012359|Ga0137385_11604556 | Not Available | 514 | Open in IMG/M |
| 3300012362|Ga0137361_11255121 | Not Available | 665 | Open in IMG/M |
| 3300012364|Ga0134027_1126527 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300012373|Ga0134042_1008126 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1067 | Open in IMG/M |
| 3300012373|Ga0134042_1036506 | Not Available | 957 | Open in IMG/M |
| 3300012373|Ga0134042_1059674 | Not Available | 855 | Open in IMG/M |
| 3300012376|Ga0134032_1039676 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1396 | Open in IMG/M |
| 3300012376|Ga0134032_1131126 | Not Available | 620 | Open in IMG/M |
| 3300012380|Ga0134047_1178764 | Not Available | 651 | Open in IMG/M |
| 3300012382|Ga0134038_1099413 | Not Available | 643 | Open in IMG/M |
| 3300012382|Ga0134038_1262521 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 827 | Open in IMG/M |
| 3300012383|Ga0134033_1036716 | Not Available | 566 | Open in IMG/M |
| 3300012383|Ga0134033_1101354 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1126 | Open in IMG/M |
| 3300012391|Ga0134035_1093969 | Not Available | 524 | Open in IMG/M |
| 3300012393|Ga0134052_1073609 | Not Available | 651 | Open in IMG/M |
| 3300012393|Ga0134052_1321888 | Not Available | 599 | Open in IMG/M |
| 3300012395|Ga0134044_1309446 | Not Available | 545 | Open in IMG/M |
| 3300012396|Ga0134057_1062502 | Not Available | 899 | Open in IMG/M |
| 3300012400|Ga0134048_1182405 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300012400|Ga0134048_1387782 | Not Available | 657 | Open in IMG/M |
| 3300012402|Ga0134059_1249323 | Not Available | 609 | Open in IMG/M |
| 3300012402|Ga0134059_1333837 | Not Available | 963 | Open in IMG/M |
| 3300012403|Ga0134049_1281510 | Not Available | 654 | Open in IMG/M |
| 3300012404|Ga0134024_1081241 | Not Available | 521 | Open in IMG/M |
| 3300012404|Ga0134024_1144292 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1839 | Open in IMG/M |
| 3300012406|Ga0134053_1153876 | Not Available | 1859 | Open in IMG/M |
| 3300012406|Ga0134053_1337653 | Not Available | 592 | Open in IMG/M |
| 3300012407|Ga0134050_1268674 | Not Available | 1555 | Open in IMG/M |
| 3300012409|Ga0134045_1192538 | Not Available | 2025 | Open in IMG/M |
| 3300012469|Ga0150984_100767585 | Not Available | 2059 | Open in IMG/M |
| 3300012582|Ga0137358_10743919 | Not Available | 655 | Open in IMG/M |
| 3300012944|Ga0137410_10259543 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1364 | Open in IMG/M |
| 3300015374|Ga0132255_105771907 | Not Available | 524 | Open in IMG/M |
| 3300019249|Ga0184648_1143986 | Not Available | 529 | Open in IMG/M |
| 3300025972|Ga0207668_11490732 | Not Available | 610 | Open in IMG/M |
| 3300026118|Ga0207675_100416764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1326 | Open in IMG/M |
| 3300026296|Ga0209235_1226541 | Not Available | 598 | Open in IMG/M |
| 3300026524|Ga0209690_1253685 | Not Available | 553 | Open in IMG/M |
| 3300026548|Ga0209161_10563614 | Not Available | 509 | Open in IMG/M |
| 3300027169|Ga0209897_1019069 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300027750|Ga0209461_10091176 | Not Available | 679 | Open in IMG/M |
| 3300027954|Ga0209859_1029117 | Not Available | 934 | Open in IMG/M |
| 3300028608|Ga0247819_10695199 | Not Available | 621 | Open in IMG/M |
| 3300028878|Ga0307278_10404055 | Not Available | 600 | Open in IMG/M |
| 3300028889|Ga0247827_10805831 | Not Available | 622 | Open in IMG/M |
| 3300030571|Ga0247652_1000746 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1496 | Open in IMG/M |
| 3300030574|Ga0247648_1004644 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1382 | Open in IMG/M |
| 3300030608|Ga0247651_10008424 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1302 | Open in IMG/M |
| 3300030610|Ga0247613_10324104 | Not Available | 589 | Open in IMG/M |
| 3300030903|Ga0308206_1015393 | Not Available | 1217 | Open in IMG/M |
| 3300030903|Ga0308206_1061915 | Not Available | 768 | Open in IMG/M |
| 3300030904|Ga0308198_1024177 | Not Available | 833 | Open in IMG/M |
| 3300031092|Ga0308204_10102307 | Not Available | 791 | Open in IMG/M |
| 3300031093|Ga0308197_10100263 | Not Available | 856 | Open in IMG/M |
| 3300031096|Ga0308193_1028531 | Not Available | 759 | Open in IMG/M |
| 3300031125|Ga0308182_1003971 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300031548|Ga0307408_100391338 | Not Available | 1191 | Open in IMG/M |
| 3300031562|Ga0310886_10511700 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 726 | Open in IMG/M |
| 3300031820|Ga0307473_11448691 | Not Available | 519 | Open in IMG/M |
| 3300031995|Ga0307409_102946784 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032005|Ga0307411_10179975 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1604 | Open in IMG/M |
| 3300032180|Ga0307471_100551820 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1307 | Open in IMG/M |
| 3300032205|Ga0307472_101884799 | Not Available | 596 | Open in IMG/M |
| 3300034643|Ga0370545_028251 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300034644|Ga0370548_023479 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300034680|Ga0370541_008558 | Not Available | 994 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 39.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010089 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030571 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030574 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030608 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030610 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066672_103291843 | 3300005167 | Soil | AERGPKRPIYKRAPGPVRFSAGDEDGDEEEVHGAYGARHRADADAHDPA* |
| Ga0066677_101613561 | 3300005171 | Soil | PVKRAAHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVHDAYGARHRADADAHDPA* |
| Ga0065707_104304561 | 3300005295 | Switchgrass Rhizosphere | AHAERGPKRPIYKRAPGPVRFSTGDEDGDEEEGRGAYGARHRADADAHDPA* |
| Ga0066701_106913721 | 3300005552 | Soil | KRAAHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAPDPA* |
| Ga0066700_109152621 | 3300005559 | Soil | KRAAHAERGPKRPIYKRAPGPVRFSAGDDDGDEEEGHGAHGARRRADTGEHDPA* |
| Ga0068862_1026135731 | 3300005844 | Switchgrass Rhizosphere | AKGERGPKRPIYKRTTGPVRFSATEDDGDEEVRGAYEARRRADAGEHDPA* |
| Ga0066696_110519411 | 3300006032 | Soil | AHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA* |
| Ga0075422_103081092 | 3300006196 | Populus Rhizosphere | RATPAERGPKRPIYKRAPGPVRFSARDEDRDEEEVRGPHGARHRADAVAHDTA* |
| Ga0066665_109792321 | 3300006796 | Soil | RGPKRPMYKRAAGPVRFSAEDDDGDEEEVPGAHGARRRADAGEHDTA* |
| Ga0075428_1004805993 | 3300006844 | Populus Rhizosphere | AERGPKRPIYKRAPGPGRFSARDEDGDEEGRGAYGARHRADADAHDPA* |
| Ga0099791_100830161 | 3300007255 | Vadose Zone Soil | RPLYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA* |
| Ga0066710_1032800201 | 3300009012 | Grasslands Soil | KRDGHAEPGPKRPIYTRAPGPVRFSVGDEDGDEEEVHGAPGVCQRADEHDTT |
| Ga0099827_115866801 | 3300009090 | Vadose Zone Soil | HPIYKRAPGPVRFSAGDEDGDEEEVRGARGARQRADADEHDTA* |
| Ga0111539_108436803 | 3300009094 | Populus Rhizosphere | RPPVKRAAHAERGPKRPIYKRAPGPVRFSARDEDRDEEEVRGPHGARHRADAVAHDTA* |
| Ga0126315_101057375 | 3300010038 | Serpentine Soil | GPKRPMYKRVPGPVRFSTGDDDGDEEEMRGAHGARHRIAD* |
| Ga0127457_10455904 | 3300010081 | Grasslands Soil | AVHAERGPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0127454_10235332 | 3300010089 | Grasslands Soil | GPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA* |
| Ga0127468_10793601 | 3300010092 | Grasslands Soil | LKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0127481_11317172 | 3300010101 | Grasslands Soil | AAHAERGPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0127453_10832141 | 3300010102 | Grasslands Soil | PKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0127500_10419071 | 3300010103 | Grasslands Soil | RAVHAERGPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0127472_10746861 | 3300010106 | Grasslands Soil | AKRAVHAERGPKRPIYKRAPGPVRFSVGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0127499_10970471 | 3300010141 | Grasslands Soil | KRPIYKRTPGPVRFSAGDEDGAEEEERTAHGARQRADADEYDTA* |
| Ga0134086_101456352 | 3300010323 | Grasslands Soil | PGPVRFSAGDEDGDEEEGRGAHGARRRADADAHDTA* |
| Ga0134086_102279102 | 3300010323 | Grasslands Soil | ERGPKRPIYKRAPGPVRFSAGDEEEVRGAYGARHRADADAHDPA* |
| Ga0134065_104826322 | 3300010326 | Grasslands Soil | RRRTPAKRAAHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEEVRGAHGARQRADAHDTA* |
| Ga0134063_104386781 | 3300010335 | Grasslands Soil | GPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0126379_119231311 | 3300010366 | Tropical Forest Soil | KPAAKDLCYKRATGPVRFSPGDEDGDDEEERGAHGARRRADAGEPDTA* |
| Ga0134128_131194371 | 3300010373 | Terrestrial Soil | MYKRAAGPVRFSAEDDDSDEEEVRGAHGARRRADAGEHDTV* |
| Ga0126383_112645612 | 3300010398 | Tropical Forest Soil | MYKRVPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV* |
| Ga0137393_108945263 | 3300011271 | Vadose Zone Soil | YKRAPGPVRFSAGDEDGDEEEVRGADGARHRADADAHDPA* |
| Ga0137383_106701981 | 3300012199 | Vadose Zone Soil | MYKRAAGPVRFSAEDDDGDEEEVPGAHGARRRADAGEHDTA* |
| Ga0137381_101109814 | 3300012207 | Vadose Zone Soil | AGPVRFSAEDDDGDEEEVPGAHGARRRADADEHDTA* |
| Ga0137379_101647711 | 3300012209 | Vadose Zone Soil | PAKRAAHADHGPKRPMYKRAAGPVRFSAEDDDGDEEEMRGAHGARHRTDAAEHDTV* |
| Ga0134028_12669453 | 3300012224 | Grasslands Soil | VHAERGPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0137387_113203371 | 3300012349 | Vadose Zone Soil | KRPMYKRAPGPVRFSAGDEDGDEEEGRSAHGARQRADADEYDTA* |
| Ga0137385_116045561 | 3300012359 | Vadose Zone Soil | KRPMYKRTPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV* |
| Ga0137361_112551211 | 3300012362 | Vadose Zone Soil | MYKRAAGPVRFGAGDEDGDEEEVRGAHGARRRADAGEHDTA* |
| Ga0134027_11265271 | 3300012364 | Grasslands Soil | IYKRTPGPVRFSAGDDDSDEEEVHDAHGARQRADADEHDTA* |
| Ga0134042_10081263 | 3300012373 | Grasslands Soil | CPMYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV* |
| Ga0134042_10365061 | 3300012373 | Grasslands Soil | AERGPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0134042_10596743 | 3300012373 | Grasslands Soil | PIYKRAPGPVRFSAGDEDGDEEEEVRGAHGARQRADEHDTA* |
| Ga0134032_10396761 | 3300012376 | Grasslands Soil | GPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV* |
| Ga0134032_11311263 | 3300012376 | Grasslands Soil | KRPIYKRAPGPVRFSAGDEDSDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134047_11787641 | 3300012380 | Grasslands Soil | PIYKRAPGPVRFSAGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134038_10994133 | 3300012382 | Grasslands Soil | HAERGPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADEHDTT* |
| Ga0134038_12625211 | 3300012382 | Grasslands Soil | RPPAKRAAPAERGPKRPMYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV* |
| Ga0134033_10367161 | 3300012383 | Grasslands Soil | IYKRAPGPVRFSAGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134033_11013541 | 3300012383 | Grasslands Soil | RRPPVKRAAHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVHGAYGARHRADADAHDPA* |
| Ga0134035_10939691 | 3300012391 | Grasslands Soil | PIYKRAPGSVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA* |
| Ga0134052_10736092 | 3300012393 | Grasslands Soil | AKRAAHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAPDPA* |
| Ga0134052_13218881 | 3300012393 | Grasslands Soil | GPVRFSAGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134044_13094461 | 3300012395 | Grasslands Soil | AERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA* |
| Ga0134057_10625023 | 3300012396 | Grasslands Soil | RPIYKRAPGPVRFSAGDEDGDEEEGRSAHGARQRADADEYDTA* |
| Ga0134048_11824051 | 3300012400 | Grasslands Soil | RRPPALRAAHAERGPKRPIYKRTPGPVRFSAGDDDSDEEEVHDAHGARQRADADEHDTA* |
| Ga0134048_13877821 | 3300012400 | Grasslands Soil | RPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA* |
| Ga0134059_12493231 | 3300012402 | Grasslands Soil | HAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRSAYGARHRADADAHDPT* |
| Ga0134059_13338373 | 3300012402 | Grasslands Soil | YKRAPGPVRFSAGDEDGDEEEGRSAHGARQRADADEYDTA* |
| Ga0134049_12815101 | 3300012403 | Grasslands Soil | PKRPIYKRAPGPVRFSVGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134024_10812411 | 3300012404 | Grasslands Soil | RPIYKRAPGPVRFSAGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134024_11442921 | 3300012404 | Grasslands Soil | KRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA* |
| Ga0134053_11538761 | 3300012406 | Grasslands Soil | KAERGPKRPIYKRVPGPVRFSATDDDGDEEEVRGAHGASQHADADEHDTA* |
| Ga0134053_13376533 | 3300012406 | Grasslands Soil | AERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134050_12686745 | 3300012407 | Grasslands Soil | RAAHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAHGARQRAAADEHDTA* |
| Ga0134045_11925381 | 3300012409 | Grasslands Soil | YKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAPDPA* |
| Ga0150984_1007675855 | 3300012469 | Avena Fatua Rhizosphere | PAKRAAPAERGPKRPIYKRAPGPVRFSVGDEDGDEEEVHGAPGVRQRADAHDTA* |
| Ga0137358_107439192 | 3300012582 | Vadose Zone Soil | AKAERGPKRPIYKRAPGPVRFSAGDDDGEEEEVRGTHGASQRAEADEPDTT* |
| Ga0137410_102595431 | 3300012944 | Vadose Zone Soil | RRRPPAKRAAHAERGPKRPIYKRAPGPGRFSAGDEDGDEEEVRGADGARHRADADAHDPA |
| Ga0132255_1057719072 | 3300015374 | Arabidopsis Rhizosphere | MYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV* |
| Ga0184648_11439861 | 3300019249 | Groundwater Sediment | PIYKRVPGPVRFSAGDDDGDEGEVRGAHGASQRVDADEPDTT |
| Ga0207668_114907322 | 3300025972 | Switchgrass Rhizosphere | AKRAAPAERGPKRPMYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0207675_1004167643 | 3300026118 | Switchgrass Rhizosphere | RGAKGERGPKRPIYKRTTGPVRFSATEDDGDEEVRGAYEARRRADAGEHDPA |
| Ga0209235_12265411 | 3300026296 | Grasslands Soil | GMRGPKRPIYKRAPGSVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA |
| Ga0209690_12536851 | 3300026524 | Soil | PKRPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA |
| Ga0209161_105636142 | 3300026548 | Soil | RRTPGKRAAHAERGPKRPVYKRAPGPGRFSAGDEDGDEEEVRGAYGARHRADADAPDPA |
| Ga0209897_10190691 | 3300027169 | Groundwater Sand | AGPVRFSAVDDDGDEEEEHGAHGTQRRAAAGEHDTA |
| Ga0209461_100911763 | 3300027750 | Agave | MYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0209859_10291171 | 3300027954 | Groundwater Sand | KRAAGPVRFSAGDEDGNEEVRGAHGARRRADAGEHDTA |
| Ga0247819_106951991 | 3300028608 | Soil | IYKRAAGPVRFSTGDEDGDEEERDAHGARRRADAGEHDTA |
| Ga0307278_104040553 | 3300028878 | Soil | PPAKRAARAERGPKRSIYKRAPGPVRFSAGDEDGDEEEGRGAHGARQRADADEHDTA |
| Ga0247827_108058312 | 3300028889 | Soil | AERGPKRPMYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0247652_10007461 | 3300030571 | Soil | PPAKRAAPAERGPKRPMYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0247648_10046441 | 3300030574 | Soil | PAKRAAPAERGPKRPMYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0247651_100084244 | 3300030608 | Soil | PGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0247613_103241041 | 3300030610 | Soil | MYKRAPGPARFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0308206_10153934 | 3300030903 | Soil | HAERGPKRPIYKRALEPGRFSAGDGEGDEEEGRGDHGAPDRTDATEDDTG |
| Ga0308206_10619151 | 3300030903 | Soil | IYKRAPGPVRFSAGDEDGDEEEGHGAHGARRRADTGEHDPA |
| Ga0308198_10241772 | 3300030904 | Soil | APAKRAAQAERGPKHPMYKRAAGPVRFGAGDEDGDEEEVRGAHGARRRADAGEHDTA |
| Ga0308204_101023071 | 3300031092 | Soil | GPVRFSAGDEDEDGDEEEVRGAHGASQRADADEPDTT |
| Ga0308197_101002633 | 3300031093 | Soil | AAKAERGPKRPMYKRAPGPVRFSAGDDDGDEEEERGAHGARQRADADEHDTA |
| Ga0308193_10285314 | 3300031096 | Soil | VRFSAGDDDADGDEEEVRGAHGASQRADADEPDTT |
| Ga0308182_10039713 | 3300031125 | Soil | RRPPAKRAAKAERGPKRPMYKRAPGPVRFSAGDDDGDEEEERGAHGARQRADADEHDTA |
| Ga0307408_1003913381 | 3300031548 | Rhizosphere | IYKRAPGPVRFSAGDEGGDEEEEVRGAHGARQRADADAHDTA |
| Ga0310886_105117001 | 3300031562 | Soil | KHPLYKRAAGPVRFSTGDEDGDEEEERGAHGARRRADAGEHDTA |
| Ga0307473_114486912 | 3300031820 | Hardwood Forest Soil | HAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA |
| Ga0307409_1029467841 | 3300031995 | Rhizosphere | MYKRAPGPVRFSTGDNDGDEEEMRGAYGARHRTDAAEHDTV |
| Ga0307411_101799751 | 3300032005 | Rhizosphere | YKRAPGPVRFSTGDNDGDEEEMRGAYGARHRTDAAEHDTV |
| Ga0307471_1005518204 | 3300032180 | Hardwood Forest Soil | RRRPPAKRAAPAERGPKRPMYKRAPGPVRFSTGDDDGDEEEMRGAHGARHRTDAAEHDTV |
| Ga0307472_1018847991 | 3300032205 | Hardwood Forest Soil | PVKRAAHAERGPKRPIYKRAPGPVRFSAGDEDGDEEEVRGAYGARHRADADAHDPA |
| Ga0370545_028251_817_942 | 3300034643 | Soil | MYKRTAGPVRFSAEDDDGDEEEVPGAHGARRRADAGEPDTA |
| Ga0370548_023479_725_850 | 3300034644 | Soil | MYKRAPGPVRFSAGDDDGDEEEERGAHGARQRADADEHDTA |
| Ga0370541_008558_1_129 | 3300034680 | Soil | PIYKRAPGPVRFSAGDEDSEEEEVRGARGARQRADADEHDTA |
| ⦗Top⦘ |