


| Basic Information | |
|---|---|
| Family ID | F101372 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MATVLIVEDEDQVRVLAESYLREQGHQTVSAATAEEALA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.12 % |
| % of genes near scaffold ends (potentially truncated) | 96.08 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.902 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.588 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.922 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 14.93% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 6.86 |
| PF02738 | MoCoBD_1 | 3.92 |
| PF02663 | FmdE | 2.94 |
| PF02811 | PHP | 2.94 |
| PF00135 | COesterase | 1.96 |
| PF00441 | Acyl-CoA_dh_1 | 1.96 |
| PF03401 | TctC | 0.98 |
| PF07733 | DNA_pol3_alpha | 0.98 |
| PF04454 | Linocin_M18 | 0.98 |
| PF13518 | HTH_28 | 0.98 |
| PF07536 | HWE_HK | 0.98 |
| PF01850 | PIN | 0.98 |
| PF00563 | EAL | 0.98 |
| PF03372 | Exo_endo_phos | 0.98 |
| PF01553 | Acyltransferase | 0.98 |
| PF02518 | HATPase_c | 0.98 |
| PF01977 | UbiD | 0.98 |
| PF09347 | DUF1989 | 0.98 |
| PF10431 | ClpB_D2-small | 0.98 |
| PF10518 | TAT_signal | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2191 | Formylmethanofuran dehydrogenase subunit E | Energy production and conversion [C] | 2.94 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.96 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.96 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.98 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.98 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.98 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.98 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.98 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.98 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.98 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.98 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.98 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.90 % |
| All Organisms | root | All Organisms | 45.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908006|FWIROz_GKA24FP02FPLQ9 | Not Available | 512 | Open in IMG/M |
| 3300001867|JGI12627J18819_10214167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300004114|Ga0062593_102269925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. CBZ-4 | 609 | Open in IMG/M |
| 3300005160|Ga0066820_1001548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300005181|Ga0066678_10725490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300005332|Ga0066388_104687948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300005332|Ga0066388_105260368 | Not Available | 656 | Open in IMG/M |
| 3300005435|Ga0070714_101023539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300005446|Ga0066686_10736550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300005560|Ga0066670_10707278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300005764|Ga0066903_108170494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300006046|Ga0066652_100609391 | Not Available | 1031 | Open in IMG/M |
| 3300006057|Ga0075026_100612665 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006237|Ga0097621_101775189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300006800|Ga0066660_11423678 | Not Available | 544 | Open in IMG/M |
| 3300006806|Ga0079220_11237857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium fujisawaense | 620 | Open in IMG/M |
| 3300006852|Ga0075433_11700593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 543 | Open in IMG/M |
| 3300006893|Ga0073928_10378197 | Not Available | 1041 | Open in IMG/M |
| 3300006914|Ga0075436_100771162 | Not Available | 715 | Open in IMG/M |
| 3300009092|Ga0105250_10539015 | Not Available | 534 | Open in IMG/M |
| 3300010159|Ga0099796_10528805 | Not Available | 529 | Open in IMG/M |
| 3300010358|Ga0126370_10102053 | Not Available | 1987 | Open in IMG/M |
| 3300010359|Ga0126376_11242819 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010360|Ga0126372_11001394 | Not Available | 847 | Open in IMG/M |
| 3300010360|Ga0126372_11545140 | Not Available | 701 | Open in IMG/M |
| 3300010362|Ga0126377_12450218 | Not Available | 598 | Open in IMG/M |
| 3300010366|Ga0126379_12815398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 582 | Open in IMG/M |
| 3300010371|Ga0134125_11665546 | Not Available | 694 | Open in IMG/M |
| 3300010376|Ga0126381_103277562 | Not Available | 639 | Open in IMG/M |
| 3300012212|Ga0150985_122370778 | Not Available | 504 | Open in IMG/M |
| 3300012494|Ga0157341_1035926 | Not Available | 555 | Open in IMG/M |
| 3300012908|Ga0157286_10192645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300012924|Ga0137413_10191517 | Not Available | 1368 | Open in IMG/M |
| 3300012948|Ga0126375_10529385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 885 | Open in IMG/M |
| 3300012948|Ga0126375_11491398 | Not Available | 577 | Open in IMG/M |
| 3300012960|Ga0164301_10275958 | Not Available | 1118 | Open in IMG/M |
| 3300014499|Ga0182012_10324721 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300015371|Ga0132258_11718218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1583 | Open in IMG/M |
| 3300016294|Ga0182041_10439641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300016294|Ga0182041_11250568 | Not Available | 678 | Open in IMG/M |
| 3300016294|Ga0182041_11705090 | Not Available | 583 | Open in IMG/M |
| 3300016357|Ga0182032_10080563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0158 | 2235 | Open in IMG/M |
| 3300016357|Ga0182032_10124300 | Not Available | 1867 | Open in IMG/M |
| 3300016422|Ga0182039_10366261 | Not Available | 1214 | Open in IMG/M |
| 3300016422|Ga0182039_11526739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 609 | Open in IMG/M |
| 3300016445|Ga0182038_10905773 | Not Available | 777 | Open in IMG/M |
| 3300017936|Ga0187821_10129363 | Not Available | 945 | Open in IMG/M |
| 3300017942|Ga0187808_10102539 | Not Available | 1245 | Open in IMG/M |
| 3300018034|Ga0187863_10510828 | Not Available | 673 | Open in IMG/M |
| 3300018433|Ga0066667_10819404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300021168|Ga0210406_10846582 | Not Available | 692 | Open in IMG/M |
| 3300021170|Ga0210400_11499394 | Not Available | 535 | Open in IMG/M |
| 3300021402|Ga0210385_10085215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2176 | Open in IMG/M |
| 3300022557|Ga0212123_10904704 | Not Available | 519 | Open in IMG/M |
| 3300025893|Ga0207682_10172444 | Not Available | 984 | Open in IMG/M |
| 3300025906|Ga0207699_11486979 | Not Available | 501 | Open in IMG/M |
| 3300025916|Ga0207663_11348776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. apii | 574 | Open in IMG/M |
| 3300025918|Ga0207662_11051952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300025928|Ga0207700_10723820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300025929|Ga0207664_12015706 | Not Available | 500 | Open in IMG/M |
| 3300026041|Ga0207639_11042764 | Not Available | 766 | Open in IMG/M |
| 3300026078|Ga0207702_11584812 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026317|Ga0209154_1090318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1313 | Open in IMG/M |
| 3300026551|Ga0209648_10399534 | Not Available | 903 | Open in IMG/M |
| 3300027854|Ga0209517_10128598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1655 | Open in IMG/M |
| 3300027869|Ga0209579_10363858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas mucosa | 783 | Open in IMG/M |
| 3300027905|Ga0209415_10840760 | Not Available | 633 | Open in IMG/M |
| 3300028536|Ga0137415_10417876 | Not Available | 1146 | Open in IMG/M |
| 3300028708|Ga0307295_10156615 | Not Available | 634 | Open in IMG/M |
| 3300028712|Ga0307285_10098434 | Not Available | 771 | Open in IMG/M |
| 3300028824|Ga0307310_10387381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 692 | Open in IMG/M |
| 3300028906|Ga0308309_11662833 | Not Available | 542 | Open in IMG/M |
| 3300031234|Ga0302325_12266237 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031446|Ga0170820_15793218 | Not Available | 534 | Open in IMG/M |
| 3300031543|Ga0318516_10830177 | Not Available | 521 | Open in IMG/M |
| 3300031549|Ga0318571_10108821 | Not Available | 916 | Open in IMG/M |
| 3300031573|Ga0310915_10761530 | Not Available | 682 | Open in IMG/M |
| 3300031573|Ga0310915_10990039 | Not Available | 587 | Open in IMG/M |
| 3300031708|Ga0310686_113701324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas mucosa | 616 | Open in IMG/M |
| 3300031719|Ga0306917_10046897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2885 | Open in IMG/M |
| 3300031719|Ga0306917_11437761 | Not Available | 531 | Open in IMG/M |
| 3300031744|Ga0306918_11178095 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031744|Ga0306918_11420678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031768|Ga0318509_10648576 | Not Available | 587 | Open in IMG/M |
| 3300031771|Ga0318546_10416050 | Not Available | 939 | Open in IMG/M |
| 3300031777|Ga0318543_10049937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1703 | Open in IMG/M |
| 3300031821|Ga0318567_10430604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300031833|Ga0310917_10943317 | Not Available | 580 | Open in IMG/M |
| 3300031833|Ga0310917_11000461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300031879|Ga0306919_10469244 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300031896|Ga0318551_10741060 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031910|Ga0306923_11978214 | Not Available | 592 | Open in IMG/M |
| 3300031941|Ga0310912_10107011 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300031942|Ga0310916_11622562 | Not Available | 525 | Open in IMG/M |
| 3300031946|Ga0310910_11334820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031954|Ga0306926_10154428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2843 | Open in IMG/M |
| 3300032025|Ga0318507_10178699 | Not Available | 913 | Open in IMG/M |
| 3300032059|Ga0318533_10047707 | Not Available | 2843 | Open in IMG/M |
| 3300032205|Ga0307472_101143687 | Not Available | 740 | Open in IMG/M |
| 3300033289|Ga0310914_10854070 | Not Available | 809 | Open in IMG/M |
| 3300033475|Ga0310811_11483807 | Not Available | 507 | Open in IMG/M |
| 3300034268|Ga0372943_1175151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 51753 | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908006 | Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIROz_03972670 | 2124908006 | Soil | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQA |
| JGI12627J18819_102141672 | 3300001867 | Forest Soil | MATVLLAEDDDQVRVLAESYLEEQGHEVLSAGTAPGALALLDKT |
| Ga0062593_1022699251 | 3300004114 | Soil | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQALALIEE |
| Ga0066820_10015481 | 3300005160 | Soil | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQALAVIQ |
| Ga0066678_107254902 | 3300005181 | Soil | MATVLIVEDEDQVRVLAESYLREQGHQTVSAATAEEALAVFEV |
| Ga0066388_1046879482 | 3300005332 | Tropical Forest Soil | MGTVLIVEDEDQVRVLAESYLREQGHQTVSAATADEALAVFD |
| Ga0066388_1052603681 | 3300005332 | Tropical Forest Soil | MATILIVEDENQVRVFAESYLRQQGHRTISAASAEEALALI |
| Ga0070714_1010235392 | 3300005435 | Agricultural Soil | MGAVFRGIPMAIVLLAEDDDQVRVLAESYLEEQGHEVLSAGTAPGALALLDK |
| Ga0066686_107365502 | 3300005446 | Soil | MAAILVVEDEEQVRVLAESYLREQGHETFSAATREQALAVLD |
| Ga0066670_107072782 | 3300005560 | Soil | MATVVLVEGDDQVRVLAESYLEEQGHEVLSAGTAAGAL |
| Ga0066903_1081704941 | 3300005764 | Tropical Forest Soil | MATVLIVEDEDQVRVLAESYLREQGHQTVSAATAEEGLAVFEVVERIDVLF |
| Ga0066652_1006093914 | 3300006046 | Soil | MAIVLLVEDEERVRVLAQSYLDEQGHEVLSAGTPQGAIALLEKAPHVDVLF |
| Ga0075026_1006126652 | 3300006057 | Watersheds | MACVLIVEDEDQVRVLADSYLQQQGHKTFSASTIDGALALLDGDQ |
| Ga0097621_1017751892 | 3300006237 | Miscanthus Rhizosphere | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQALAVIQERA |
| Ga0066660_114236781 | 3300006800 | Soil | MATILIVEDENQVRVFAESYLRRQGHRTISAATVEEALTLIDA |
| Ga0079220_112378571 | 3300006806 | Agricultural Soil | MAVVLLVEDEEQVRVLAQSYLEEQGHKVLSAGTPRGAIALL |
| Ga0075433_117005932 | 3300006852 | Populus Rhizosphere | MSLVLIVEDEEALRVLAESIIQHHGYEALSAGTVEQA |
| Ga0073928_103781971 | 3300006893 | Iron-Sulfur Acid Spring | MAVVLVVEDEDQVRVLAESYLQEHGHQTRSASTVPEALALLDS |
| Ga0075436_1007711621 | 3300006914 | Populus Rhizosphere | MATILIVEDENQVRVFAESYLRRQGHRTISAATVEEAL |
| Ga0105250_105390151 | 3300009092 | Switchgrass Rhizosphere | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQ |
| Ga0099796_105288052 | 3300010159 | Vadose Zone Soil | MAVVLIVEDEEQVRVLAEAIIQDLGHETLTAGTAEQALAVVQE |
| Ga0126370_101020531 | 3300010358 | Tropical Forest Soil | MANILIVEDEDHLRVLTESYLREQGHVTFSAATKEQA |
| Ga0126376_112428192 | 3300010359 | Tropical Forest Soil | MATVLIVEDEDQVRVLAESYLREQGHQTVSAATAEEGLAVF |
| Ga0126372_110013942 | 3300010360 | Tropical Forest Soil | MTDMATVLIVEDEDQVRVLAGSYLREQGHQTVSAATAEEALAVFDVVERI |
| Ga0126372_115451401 | 3300010360 | Tropical Forest Soil | MAVVLVVEDEDQVRVLAESYLEEQGHQVLSAGTPAGAL |
| Ga0126377_124502182 | 3300010362 | Tropical Forest Soil | MATVLLVEGEDQVRVLAESYLEEQGHEVLSAGTPDGAL |
| Ga0126379_128153981 | 3300010366 | Tropical Forest Soil | MATVLLVEGDDQVRVLAESYLEEQGHEVLSAGTAPGA |
| Ga0134125_116655462 | 3300010371 | Terrestrial Soil | MAVLIVEDDEQVRVLAESVLQGEGFATLSAGTVEQAE* |
| Ga0126381_1032775621 | 3300010376 | Tropical Forest Soil | MAVVLVVEDEDQVRVLAESYLEEQGHRVLSAGTPAGA |
| Ga0150985_1223707782 | 3300012212 | Avena Fatua Rhizosphere | MATILVAESEEQVRVLAQSYLREQGHETLSAATKEK |
| Ga0157341_10359262 | 3300012494 | Arabidopsis Rhizosphere | MAVVLIVEDEEQVRVLAEAIIRELGHETLTAGTAEQALP* |
| Ga0157286_101926451 | 3300012908 | Soil | MAVVLIVEDEEQVRVLAEAIIQDLGHETLTAGTAEQALAIM |
| Ga0137413_101915171 | 3300012924 | Vadose Zone Soil | MVSILIVEDEEQVRVLAESYLREQGHQTLSAATMDQAL |
| Ga0126375_105293851 | 3300012948 | Tropical Forest Soil | MAAILVVEDEEQVRVLAESYLREQGHETFSAATKEQALAVLDVT |
| Ga0126375_114913981 | 3300012948 | Tropical Forest Soil | MATILIVEDEEQVRVLAESYLREQGHQTLSAATKEQALALLETETVD |
| Ga0164301_102759581 | 3300012960 | Soil | MAVVLIVEDEEQGRVLAEAIVQELGHETLTAGTAEQALAVIQERADVDLL |
| Ga0182012_103247212 | 3300014499 | Bog | MAVVLVVEDEEQVRVLAESYLQEHGHQTVSAATAEEALAALGVAD |
| Ga0132258_117182183 | 3300015371 | Arabidopsis Rhizosphere | MTVVLIVEDEEQVRVLAEAIIRELGHETLTAGTAEQAL |
| Ga0182041_104396411 | 3300016294 | Soil | MATVLLVEGEDQVRVLAESYLEEQGHEVLSAGTPDGALALLEKSPHVDILFTD |
| Ga0182041_112505681 | 3300016294 | Soil | MAVILLVEDEEQVRILAQSYLEEQGHKVLTAGTPDGAMAILQRTDHVDLL |
| Ga0182041_117050903 | 3300016294 | Soil | MASVLIVEDEDQVRVLAKSYLREQGHQTVSAATAEEVLAVFE |
| Ga0182032_100805636 | 3300016357 | Soil | MASVLIVEDEDQVRVLAKSYLREQGHQTVSAATAEEVLAVFEGVERIDVL |
| Ga0182032_101243003 | 3300016357 | Soil | MAVVLVVEDEEQVRVLAESYLEEQGHQVLSAGTAAGALAILHRSPAV |
| Ga0182039_103662611 | 3300016422 | Soil | MAVVLIVEDEDQVRVLAESYLEEQGHQVLSAGTPAGALALLHQLPA |
| Ga0182039_115267391 | 3300016422 | Soil | MATVLLVEGDDHASVLAESYLEEQGHEVLSAGTAPGA |
| Ga0182038_109057731 | 3300016445 | Soil | MASVLIVEDEDQVRVLAKSYLREQGHQTVSAATAEEVLA |
| Ga0187821_101293633 | 3300017936 | Freshwater Sediment | MATVLLAEDDDQVRVLAESYLEEQGHEVLSAGTAPGALALLAK |
| Ga0187808_101025391 | 3300017942 | Freshwater Sediment | MATILLVEEEDQVRLLAESYLEEQGHQVLSAGTPEGAL |
| Ga0187863_105108283 | 3300018034 | Peatland | MAVILVVEDEEQIRVLVESILVDDGHQTLSAAATAQALAVIQTDHP |
| Ga0066667_108194042 | 3300018433 | Grasslands Soil | MAVILLVEDEEQVRVLGESYLEEQGHQVLSAGTLQDVMAVLENT |
| Ga0210406_108465823 | 3300021168 | Soil | MGAVFRGIPMAIVLLAEDDDQVRVLAESYLEEQGHEVLSAGTAPGALALLDKTSE |
| Ga0210400_114993941 | 3300021170 | Soil | MALVLIVEDEEQVRVLSESYLREQGHRTLSASTTEEALAVLDVADG |
| Ga0210385_100852151 | 3300021402 | Soil | MAVVLIVEDEEQVRVLAESYLQEHGHQTLSAANAEEALA |
| Ga0212123_109047041 | 3300022557 | Iron-Sulfur Acid Spring | MAVVMVVEDEDQVRVLAESYLQEHGHQTRSASTVPEALALLDSGKPIDV |
| Ga0207682_101724442 | 3300025893 | Miscanthus Rhizosphere | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQALAV |
| Ga0207699_114869791 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVLIVEDEDQVRVLAESYLREQGHQTVSAATAEEALA |
| Ga0207663_113487762 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MATILIVEDQRQVRVFAESYLRQQGHRTISAGTPEEALALIE |
| Ga0207662_110519521 | 3300025918 | Switchgrass Rhizosphere | MAVVLIVEDEEQVRVLAEAIIQDLGHETLTAGTAEQALAIMQERP |
| Ga0207700_107238201 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVLLVEGDDQVRVLAESYLEEQGHEVLSAGTAAG |
| Ga0207664_120157061 | 3300025929 | Agricultural Soil | MATVLIVEDEDQVRVLAESYLREQGHQTVSAATAEEALAVF |
| Ga0207639_110427641 | 3300026041 | Corn Rhizosphere | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQALAVI |
| Ga0207702_115848121 | 3300026078 | Corn Rhizosphere | MAVVLIVEDEEQVRVLAEAIIQDLGHETLTAGTAEQALAIMQDRP |
| Ga0209154_10903183 | 3300026317 | Soil | MATVLIVEDEDQVRVLAESYLREQGHQTVSAATAEEALAV |
| Ga0209648_103995343 | 3300026551 | Grasslands Soil | MAVVLIVEDDEQVRVLAESIIQDTGHETLTAANTDEALA |
| Ga0209517_101285983 | 3300027854 | Peatlands Soil | MAVVLIVEDKEPVRVLAEWCFQEHGHQTLSASTVDEALAV |
| Ga0209579_103638581 | 3300027869 | Surface Soil | MAVVLIVEDEEQVRVLAESYLQEQGHQTVSAATADE |
| Ga0209415_108407602 | 3300027905 | Peatlands Soil | MAVVLIIEDREPVRMLAEWCFQEHGHQTLSASTVDEALAV |
| Ga0137415_104178762 | 3300028536 | Vadose Zone Soil | MAVVLVVDDEDQVRVLAESILQGMGFQTLSAATVDQALALIRAEPSI |
| Ga0307295_101566152 | 3300028708 | Soil | MAVVLIVEDEEQVRVLAEAIIQDLGHETLTAGTAEQALAVVQ |
| Ga0307285_100984341 | 3300028712 | Soil | MAVVLIVEDEEQVRVLAEAIVQELGHETLTAGTAEQTLAV |
| Ga0307310_103873811 | 3300028824 | Soil | MAVVLIVEDEEQVRVLAEAIIQDLGHETLTAGTAEQALAVVQERPD |
| Ga0308309_116628331 | 3300028906 | Soil | MAVVLVVEDEDQVRVLAESYLQEQGHRTFSASTVNEALAVLDE |
| Ga0302325_122662372 | 3300031234 | Palsa | VAVVLIVEDEESLRVLAESIIQDRGHTTLSASTLEQAI |
| Ga0170820_157932181 | 3300031446 | Forest Soil | MATILVVEDEEQVLVLTESYLREQGHQTVSAATAEQASAILDGTERVDV |
| Ga0318516_108301771 | 3300031543 | Soil | MATILIVEHEKQVRVFAESYLQRQGHRTISTETSAQALALIEAVDGVDVLFSE |
| Ga0318571_101088211 | 3300031549 | Soil | MATVLLVEGEDQVRVLAESYLEEQGHEVLSAGTPDGALALLEKSPHVD |
| Ga0310915_107615301 | 3300031573 | Soil | MAVVLLVEDEEQVRVLAQSYLEEQGHEVLSAGSPNGALALLEK |
| Ga0310915_109900393 | 3300031573 | Soil | MASVLIVEDEDQVRVLAKSYLREQGHQTVSAATAEEVLAV |
| Ga0310686_1137013242 | 3300031708 | Soil | MAVVLIVEDEEQVRVLAESYLQEQGHQTVSAATADEALAALEA |
| Ga0306917_100468973 | 3300031719 | Soil | MATVLLVEDDDQVRVLAESYLEEQGHEVLSAGTASALHDRTQ |
| Ga0306917_114377611 | 3300031719 | Soil | LARILIVEDEEQVRVLAESYLREQGHETLSAATREQALALLEVAK |
| Ga0306918_111780952 | 3300031744 | Soil | MGTVLIVEDEDQVRVLAESYLREQGHQTVSAATPEEALAV |
| Ga0306918_114206782 | 3300031744 | Soil | MATVLLVEDDDQVRVLAESYLEEQGHEVLSAGTAPGALALLAKSSQL |
| Ga0318509_106485761 | 3300031768 | Soil | MAVVLIVEDEDQVRVLAESYLEEQGHQVLSAGTPAGALALL |
| Ga0318546_104160501 | 3300031771 | Soil | MATVLLVEGEDQVRVLAESYLEEQGHEVLSAGTPTNSA |
| Ga0318543_100499371 | 3300031777 | Soil | MATVLLVEDDDQVRVLAESYLEEQGHEVLSAGTAPGALALLAKSSQLEL |
| Ga0318567_104306041 | 3300031821 | Soil | MATVLLVEDDDQVRVLAESYLEEQGHEVLSAGTASALHDRTQSDRQARF |
| Ga0310917_109433171 | 3300031833 | Soil | MAVALVVEDEDQVRVLAESYLEVQGHQVLSAGTPAGA |
| Ga0310917_110004611 | 3300031833 | Soil | MATVLLVEDDDQVRVLAESYLEEQGHEVLSAGTAPGALALL |
| Ga0306919_104692441 | 3300031879 | Soil | MATVLLVEDDDQVRVLAESYLEEQGHEVLSAGTASA |
| Ga0318551_107410602 | 3300031896 | Soil | MGTVLIVEDEDQVRVLAESYLREQGHQTVSAATRE |
| Ga0306923_119782141 | 3300031910 | Soil | MAVALVVEDEDQVRVLAESYLEVQGHQVLSAGTPAARTS |
| Ga0310912_101070111 | 3300031941 | Soil | LARILIVEDEEQVRVLAESYLREQGHETLSAATREQALALLEI |
| Ga0310916_116225621 | 3300031942 | Soil | MAVVLVVEDEDQVRVLAESYLEEQGHQVLSAGTPAGALALRVNCRR |
| Ga0310910_113348202 | 3300031946 | Soil | MATVLLVEEDDQVRVLAESYLEEQGHEVLSAGTAPGALALLAKTSQLE |
| Ga0306926_101544285 | 3300031954 | Soil | LARILIVEDEEQVRVLAESYLREQGHETLSAATREQALALLEIAKGVDL |
| Ga0318507_101786993 | 3300032025 | Soil | MAVVLVVEDEEQVRVLAESYLEEQGHQVLSAGTAAGALAI |
| Ga0318533_100477071 | 3300032059 | Soil | MATVLLVEDDDQVRVLAESYLEEQGHEVLSARTAPGALALLAK |
| Ga0307472_1011436872 | 3300032205 | Hardwood Forest Soil | MATVLIAEDEDQVRVLAESYLQEQGHQTVSAASIEEGLA |
| Ga0310914_108540702 | 3300033289 | Soil | LARILIVEDEEQVRVLAESYLREQGHETLSAATREQALALLEVAKGVDLL |
| Ga0310811_114838071 | 3300033475 | Soil | MAVVLIVEDEEQVRVLAEAIIQDLGHETLTAGTAEQALAIMQ |
| Ga0372943_1175151_381_512 | 3300034268 | Soil | MAVVLVVEDEEQVRVLADAIIGELGYETLTAGTAEQALALVLER |
| ⦗Top⦘ |