


| Basic Information | |
|---|---|
| Family ID | F101126 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MPKFIVDLWLDGYETEEEMEDACEEFIYEQLNFSASSVKIERVNE |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.37 % |
| % of genes near scaffold ends (potentially truncated) | 16.67 % |
| % of genes from short scaffolds (< 2000 bps) | 68.63 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.69 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (27.451 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 0.00% Coil/Unstructured: 73.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF09414 | RNA_ligase | 6.86 |
| PF00004 | AAA | 1.96 |
| PF01139 | RtcB | 1.96 |
| PF02739 | 5_3_exonuc_N | 1.96 |
| PF04965 | GPW_gp25 | 0.98 |
| PF00106 | adh_short | 0.98 |
| PF00149 | Metallophos | 0.98 |
| PF09834 | DUF2061 | 0.98 |
| PF05226 | CHASE2 | 0.98 |
| PF00805 | Pentapeptide | 0.98 |
| PF01966 | HD | 0.98 |
| PF00011 | HSP20 | 0.98 |
| PF03819 | MazG | 0.98 |
| PF02086 | MethyltransfD12 | 0.98 |
| PF01227 | GTP_cyclohydroI | 0.98 |
| PF01981 | PTH2 | 0.98 |
| PF01467 | CTP_transf_like | 0.98 |
| PF01612 | DNA_pol_A_exo1 | 0.98 |
| PF09152 | DUF1937 | 0.98 |
| PF00574 | CLP_protease | 0.98 |
| PF16861 | Carbam_trans_C | 0.98 |
| PF00462 | Glutaredoxin | 0.98 |
| PF08241 | Methyltransf_11 | 0.98 |
| PF10263 | SprT-like | 0.98 |
| PF10431 | ClpB_D2-small | 0.98 |
| PF14239 | RRXRR | 0.98 |
| PF01068 | DNA_ligase_A_M | 0.98 |
| PF00085 | Thioredoxin | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.96 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 1.96 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.98 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.98 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.98 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.98 |
| COG1990 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.98 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10202579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → Gallionellales bacterium 24-53-125 | 635 | Open in IMG/M |
| 3300000177|TB18AUG2009H_c000056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34600 | Open in IMG/M |
| 3300001605|Draft_10083426 | All Organisms → Viruses → Predicted Viral | 2426 | Open in IMG/M |
| 3300003885|Ga0063294_10086396 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300004775|Ga0007798_10016712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1655 | Open in IMG/M |
| 3300005805|Ga0079957_1000386 | Not Available | 39082 | Open in IMG/M |
| 3300005831|Ga0074471_10069008 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
| 3300005831|Ga0074471_10696854 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300005957|Ga0081535_100267 | Not Available | 44124 | Open in IMG/M |
| 3300006056|Ga0075163_10320133 | Not Available | 1758 | Open in IMG/M |
| 3300006484|Ga0070744_10238318 | Not Available | 515 | Open in IMG/M |
| 3300006641|Ga0075471_10000117 | Not Available | 38991 | Open in IMG/M |
| 3300006641|Ga0075471_10316110 | Not Available | 793 | Open in IMG/M |
| 3300006810|Ga0070754_10050544 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
| 3300006810|Ga0070754_10074952 | All Organisms → Viruses → Predicted Viral | 1720 | Open in IMG/M |
| 3300007171|Ga0102977_1180257 | All Organisms → cellular organisms → Bacteria | 3986 | Open in IMG/M |
| 3300007363|Ga0075458_10083018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
| 3300007535|Ga0102926_1000053 | Not Available | 53072 | Open in IMG/M |
| 3300007538|Ga0099851_1200263 | Not Available | 727 | Open in IMG/M |
| 3300007541|Ga0099848_1066921 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300007609|Ga0102945_1046522 | Not Available | 859 | Open in IMG/M |
| 3300007635|Ga0102925_1000273 | Not Available | 27075 | Open in IMG/M |
| 3300007723|Ga0102928_1119872 | Not Available | 1198 | Open in IMG/M |
| 3300007960|Ga0099850_1204067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → Gallionellales bacterium 24-53-125 | 777 | Open in IMG/M |
| 3300008116|Ga0114350_1001879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17311 | Open in IMG/M |
| 3300009009|Ga0105105_10010391 | All Organisms → Viruses → Predicted Viral | 3732 | Open in IMG/M |
| 3300009081|Ga0105098_10012836 | Not Available | 3113 | Open in IMG/M |
| 3300009136|Ga0118735_10189045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 671 | Open in IMG/M |
| 3300009149|Ga0114918_10035738 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → unclassified Thermococci → Thermococci archaeon | 3486 | Open in IMG/M |
| 3300009149|Ga0114918_10099886 | All Organisms → Viruses → Predicted Viral | 1805 | Open in IMG/M |
| 3300009157|Ga0105092_10112519 | Not Available | 1499 | Open in IMG/M |
| 3300009168|Ga0105104_10200853 | Not Available | 1083 | Open in IMG/M |
| 3300009169|Ga0105097_10074438 | Not Available | 1843 | Open in IMG/M |
| 3300009170|Ga0105096_10333982 | Not Available | 776 | Open in IMG/M |
| 3300010157|Ga0114964_10039472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2533 | Open in IMG/M |
| 3300010157|Ga0114964_10107017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1384 | Open in IMG/M |
| 3300010300|Ga0129351_1076872 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300010354|Ga0129333_10174304 | All Organisms → Viruses → Predicted Viral | 1966 | Open in IMG/M |
| 3300010354|Ga0129333_10343042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300012964|Ga0153916_11429412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Komeilibacteria → Candidatus Komeilibacteria bacterium CG11_big_fil_rev_8_21_14_0_20_36_20 | 768 | Open in IMG/M |
| 3300014169|Ga0181531_10713368 | Not Available | 624 | Open in IMG/M |
| 3300014204|Ga0172381_10053310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3463 | Open in IMG/M |
| 3300014204|Ga0172381_10410484 | Not Available | 1058 | Open in IMG/M |
| 3300014204|Ga0172381_10701917 | Not Available | 766 | Open in IMG/M |
| 3300014204|Ga0172381_11213822 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 549 | Open in IMG/M |
| 3300014498|Ga0182019_10833314 | Not Available | 661 | Open in IMG/M |
| 3300017963|Ga0180437_10174938 | Not Available | 1714 | Open in IMG/M |
| 3300018059|Ga0184615_10121779 | Not Available | 1471 | Open in IMG/M |
| 3300018065|Ga0180430_10344046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300019756|Ga0194023_1001563 | All Organisms → Viruses → Predicted Viral | 4509 | Open in IMG/M |
| 3300020228|Ga0194040_1100591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Metrivirus → Metrivirus ME3 | 846 | Open in IMG/M |
| 3300020689|Ga0214210_1001554 | All Organisms → Viruses → Predicted Viral | 3439 | Open in IMG/M |
| 3300021125|Ga0214211_1000063 | Not Available | 40510 | Open in IMG/M |
| 3300021602|Ga0194060_10002726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12553 | Open in IMG/M |
| 3300021602|Ga0194060_10087133 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
| 3300022555|Ga0212088_10337332 | Not Available | 1062 | Open in IMG/M |
| 3300023481|Ga0257022_1000927 | Not Available | 6396 | Open in IMG/M |
| (restricted) 3300024057|Ga0255051_10096609 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10448388 | Not Available | 550 | Open in IMG/M |
| 3300024239|Ga0247724_1040919 | Not Available | 681 | Open in IMG/M |
| 3300024262|Ga0210003_1106507 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300024262|Ga0210003_1197725 | Not Available | 826 | Open in IMG/M |
| 3300024346|Ga0244775_11515414 | Not Available | 512 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10256766 | Not Available | 800 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10058512 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
| 3300025364|Ga0208354_1000394 | Not Available | 24077 | Open in IMG/M |
| 3300025447|Ga0208102_1023265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300025447|Ga0208102_1032147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300025646|Ga0208161_1074160 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
| 3300025671|Ga0208898_1054276 | Not Available | 1433 | Open in IMG/M |
| 3300025732|Ga0208784_1002144 | Not Available | 7935 | Open in IMG/M |
| 3300025853|Ga0208645_1078283 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
| 3300025948|Ga0210088_1059040 | Not Available | 609 | Open in IMG/M |
| 3300026156|Ga0209936_1000639 | Not Available | 20759 | Open in IMG/M |
| 3300027693|Ga0209704_1012643 | Not Available | 2036 | Open in IMG/M |
| 3300027721|Ga0209492_1063840 | Not Available | 1301 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10257394 | Not Available | 852 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10000803 | Not Available | 23843 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10045665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2456 | Open in IMG/M |
| 3300027917|Ga0209536_101104307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
| 3300028283|Ga0268283_1021065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2196 | Open in IMG/M |
| 3300028647|Ga0272412_1132109 | Not Available | 1057 | Open in IMG/M |
| 3300028920|Ga0272441_10646786 | Not Available | 837 | Open in IMG/M |
| 3300029826|Ga0134619_1001019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 9470 | Open in IMG/M |
| 3300031565|Ga0307379_11593299 | Not Available | 515 | Open in IMG/M |
| 3300031566|Ga0307378_10635876 | Not Available | 929 | Open in IMG/M |
| 3300031566|Ga0307378_10792256 | Not Available | 800 | Open in IMG/M |
| 3300031578|Ga0307376_10007462 | Not Available | 9518 | Open in IMG/M |
| 3300031669|Ga0307375_10166899 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
| 3300031669|Ga0307375_10609008 | Not Available | 642 | Open in IMG/M |
| 3300031758|Ga0315907_10647890 | Not Available | 812 | Open in IMG/M |
| 3300031758|Ga0315907_10706247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300031857|Ga0315909_10340555 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300031857|Ga0315909_10941395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 528 | Open in IMG/M |
| 3300032053|Ga0315284_10531228 | Not Available | 1420 | Open in IMG/M |
| 3300032053|Ga0315284_10691201 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300032260|Ga0316192_10704291 | Not Available | 681 | Open in IMG/M |
| 3300032272|Ga0316189_10803496 | Not Available | 715 | Open in IMG/M |
| 3300033429|Ga0316193_10094482 | Not Available | 2337 | Open in IMG/M |
| 3300033521|Ga0316616_100065524 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300033994|Ga0334996_0556760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300034106|Ga0335036_0604171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.84% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.92% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 3.92% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 3.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.94% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.96% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.96% |
| Hypersaline Mat | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat | 1.96% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.96% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.98% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.98% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.98% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.98% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.98% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.98% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.98% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.98% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.98% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 0.98% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.98% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.98% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.98% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.98% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000177 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300003885 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
| 3300004775 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005957 | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #3 (SPADES assembly) | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007535 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D2_MG | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007635 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D1_MG | Environmental | Open in IMG/M |
| 3300007723 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_D1_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020228 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-10m | Environmental | Open in IMG/M |
| 3300020689 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300023481 | Marine microbial mat from Loihi Seamount, Hawaii, USA - Ku'kulu Base Individual Assembly | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025364 | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025447 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025948 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026156 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028283 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300029826 | Marine sediment microbial communities from Jimmy Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - N0247 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_102025792 | 3300000116 | Marine | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASSVKIELVDELER* |
| TB18AUG2009H_00005656 | 3300000177 | Freshwater | MPKFIVELWLDGYESEEEMAAACKEFIYEQLNFSASSVTVTEIKENENDDI* |
| Draft_100834261 | 3300001605 | Hydrocarbon Resource Environments | MPKFIVELWLDGYETEEEMEAACEEFIYEQLNFTASSVEITRIEDTE* |
| Ga0063294_100863962 | 3300003885 | Hydrothermal Vents | MTKFVIDLWLDGYETEEEHDAACEEFIRDQLDFSGSSVNIIEKCEVE* |
| Ga0007798_100167122 | 3300004775 | Freshwater | MMPKFIVELWLDGYESEEEMAAACKEFIYEQLNFSASSVTVTEIKENEK* |
| Ga0079957_100038669 | 3300005805 | Lake | MPKFIVDLWLDGYESEEEMEKACEEFIYEQLNFAGSGVTIQKVDEAQEAKK* |
| Ga0074471_100690082 | 3300005831 | Sediment (Intertidal) | MPKFEVELWLDGYDSYEDMLVACEEFIYDQLDMSASSVRVKLIEADKEKE* |
| Ga0074471_106968543 | 3300005831 | Sediment (Intertidal) | MPKFEVELWLDGYDSFDDMLEACKELIYDELNMTASSVKVKLIDEQREEY* |
| Ga0081535_10026748 | 3300005957 | Hypersaline Mat | MPKFIVDLWLDGYETEEEMEEACEEFIYDQLNMTASSVKIQKIEDDE* |
| Ga0075163_103201333 | 3300006056 | Wastewater Effluent | MAKFIVDLYLDGYDTEEEMEAACEEFIYEQLNFSGSSVKVTKIEDDE* |
| Ga0070744_102383181 | 3300006484 | Estuarine | MPKFIVDLRLDGYDSEEEMSAACEEFIYDQLNFAGSGVTVTRVNEDNTNDSVDS*LGRCTRI |
| Ga0075471_1000011731 | 3300006641 | Aqueous | MPKYIVELYLDGYDSEKEMEAACDEFIYEQLNMTASSVKVTKIPDEQAS* |
| Ga0075471_103161103 | 3300006641 | Aqueous | MPKFVVDLWLDGYETEEEMIAACEEFIYEQLNFAGSSVKIERIEDTE* |
| Ga0070754_100505446 | 3300006810 | Aqueous | MAKFLVDLWLDGYDTEEEMEEACAEFIYQQLNMTASSVKIEKIEEDEHES* |
| Ga0070754_100749523 | 3300006810 | Aqueous | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASSVKIKLVDEKDLK* |
| Ga0102977_11802579 | 3300007171 | Freshwater Lake | VPKFIVDLWLDGYDTEEEMVEACKEFIYDQLNFSGSSVKIEELVETKNEKDMS* |
| Ga0075458_100830184 | 3300007363 | Aqueous | MPRFIVDLWLDGYETEEEMEAACEEFIYEQLNMTASSVTIERIEDTE* |
| Ga0102926_100005373 | 3300007535 | Pond Soil | MAKFLVELWLDGYDNEEEMIEACEEFIYENLNFSASSVEITYLSDEDEKI* |
| Ga0099851_12002632 | 3300007538 | Aqueous | MPKFIVDLWLDGYDTEEEMVDACKEFICDQLNFSASYVKIELVDEKDLK* |
| Ga0099848_10669213 | 3300007541 | Aqueous | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASYVKIELVDEKDLK* |
| Ga0102945_10465222 | 3300007609 | Pond Water | MMPRFIVELWIDGYNTKEEMEAACEEFIYEQLNFTASSVKIERIEDADNNRSGDKE* |
| Ga0102925_100027317 | 3300007635 | Pond Soil | LDGYDNEEEMIEACEEFIYENLNFSASSVEITYLSDEDEKI* |
| Ga0102928_11198723 | 3300007723 | Pond Soil | LDGYDNEEEMIEACEEFIYENLNFFASSVEITYLSDEDEKI* |
| Ga0099850_12040673 | 3300007960 | Aqueous | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASSVKIELVDEKDLK* |
| Ga0114350_10018795 | 3300008116 | Freshwater, Plankton | MMPKFLVDLWLDGYETEEEMIEACEEFIYEQLNMTASSVQIERIEDTE* |
| Ga0105105_1001039110 | 3300009009 | Freshwater Sediment | MPRFIVDLWLDGYDTEEEMISACEEFIYEQLNFTASSVKIELINGDLKK* |
| Ga0105098_1001283610 | 3300009081 | Freshwater Sediment | MPKFIVDIWLDGYESEEEMTDACEEFINDQLNFTASSVTVTRVEEGENNE* |
| Ga0118735_101890452 | 3300009136 | Marine Sediment | MPLFTLELWLDGYETEEEMIIACKEFIYNQLNMTASGVNNIQHIPDETQEDI* |
| Ga0114918_100357385 | 3300009149 | Deep Subsurface | MAKFIVELFLDGYESDEEMEDACEEFIYDQLNFSASSVTVERIKHETTDG* |
| Ga0114918_100998862 | 3300009149 | Deep Subsurface | MPKFIVDLWLDGYETEEEMEEACAEFIYQQLTMTASNVEITQIEEE* |
| Ga0105092_101125194 | 3300009157 | Freshwater Sediment | MPKFLVDLSLDGYESEAEEAAACLEFIKEQLDFSASSVTVTPIVEGDDETIPTR* |
| Ga0105104_102008532 | 3300009168 | Freshwater Sediment | MPKFIVDIWLDGYESEEEMADACEEFIYDQLNFTASSVTVTRVEE |
| Ga0105097_100744382 | 3300009169 | Freshwater Sediment | MPKFIVDIWLDGYESEEEMADACEEFIYDQLNFTASSVTVTRVEEGENNE* |
| Ga0105096_103339822 | 3300009170 | Freshwater Sediment | VPKFIVDIWLDGYESEEEMTDACEEFIYDQLNFTASSVTVTRVEEGENNE* |
| Ga0114964_100394727 | 3300010157 | Freshwater Lake | MPKFIVEIWLDGYESEEEMAAACKEFIFEQLDFSASSVTVTEIKENENDDI* |
| Ga0114964_101070172 | 3300010157 | Freshwater Lake | MMPRFIVDLWLDGYETEEEMTAACEEFIYEQLNFTASSVTITRVKEEDDE* |
| Ga0129351_10768725 | 3300010300 | Freshwater To Marine Saline Gradient | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASSVKIELVDEVER* |
| Ga0129333_101743042 | 3300010354 | Freshwater To Marine Saline Gradient | MPRFIVDLWLDGYDTEEEMIDACEEFIYEQLNFSASSVKIEKIDED* |
| Ga0129333_103430423 | 3300010354 | Freshwater To Marine Saline Gradient | MPRFIVDLWLDGYETEEEMEAACEEFIYEQLTMTASSVTIERIEDTE* |
| Ga0153916_114294122 | 3300012964 | Freshwater Wetlands | MAKFIVELWLDGYETEEEMEKACEEFILEQLDMTASSVKVTKISEEDNIKSPHPA* |
| Ga0181531_107133683 | 3300014169 | Bog | MKFIVDLEMDGYETEEEHAKACEEFIKEQLDFSASSV |
| Ga0172381_100533104 | 3300014204 | Landfill Leachate | MMAKFIVELWLDGYETKKEHDEACIEFIEEQLNMTASSVKVIQIENDENDW* |
| Ga0172381_104104843 | 3300014204 | Landfill Leachate | MKFIIDLWLDGYETEEDMEDACFEFIYEQLNFAASSIRIERYEEE* |
| Ga0172381_107019172 | 3300014204 | Landfill Leachate | MKFIVDLWLDGYETEEDMEEGCWEFLDEQLNFSASSVSIERYEDESN* |
| Ga0172381_112138223 | 3300014204 | Landfill Leachate | MKFIVDLWLDGYETEEEMEEACVEFMYENLDFSASSVTIAR |
| Ga0182019_108333144 | 3300014498 | Fen | MPRYIVDLWLDGYETEEKMEEACDEFLYEQLNMTASGVTFRTI |
| Ga0180437_101749385 | 3300017963 | Hypersaline Lake Sediment | MARFIVDLWLDGYESEEEMKEACAEFIYEQLNFAGSGVTVTPLEGEDEEE |
| Ga0184615_101217795 | 3300018059 | Groundwater Sediment | MTKFIVDLWLDGYESEEEMEKACEEFIYDQLNFSASSVKITKILD |
| Ga0180430_103440464 | 3300018065 | Hypersaline Lake Sediment | MPKFIVDLWLDGYESEEDMREACEEFIYDQLNMTASSVSIKPMKEDE |
| Ga0194023_100156318 | 3300019756 | Freshwater | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASSVKIELVDELER |
| Ga0194040_11005911 | 3300020228 | Anoxic Zone Freshwater | MMPKFIVELWLDGYESEEEMAAACKEFIFEQLDFSASSVTVTEIKEDDAPTT |
| Ga0214210_10015543 | 3300020689 | Freshwater | MMPKFIVELWLDGYESEEEMAAACKEFIYEQLNFSASSVTVTEIKENENDDI |
| Ga0214211_100006356 | 3300021125 | Freshwater | MPKFIVELWLDGYESEEEMAAACKEFIYEQLNFSASSVTVTEIKENENDDI |
| Ga0194060_1000272624 | 3300021602 | Anoxic Zone Freshwater | MMPKFIVELWLDGYESEEEMAAACKEFIYEQLDFSASSVTVTEIKEDDAPTT |
| Ga0194060_100871333 | 3300021602 | Anoxic Zone Freshwater | MMPKFIVDLWLDGYESEEEMAAACKEFIYEQLNFSASSVTVTEIKENENDDL |
| Ga0212088_103373321 | 3300022555 | Freshwater Lake Hypolimnion | MSKFIVELWLDGYETNEEMEGACLEFIEDQLNITAS |
| Ga0257022_10009276 | 3300023481 | Marine | MATFKVELWLDGYDSEEEMIAACKEFIYDQLNFAGSGVSIELMEPEDT |
| (restricted) Ga0255051_100966092 | 3300024057 | Seawater | MSKFIVDLYLDGYETEKEMEDACEEFIYDQLNFTASCVKIERIKDPATDIRSADDE |
| (restricted) Ga0255040_104483882 | 3300024059 | Seawater | MTKFVIDLWLDGYETEEEHDAACIEFIEDQLDFTASSVTVEKMETNDE |
| Ga0247724_10409193 | 3300024239 | Deep Subsurface Sediment | MPRFIVDLWLDGYDNEEEMISACEEFIYEQLNFTASSVKIKLVEEDLKDD |
| Ga0210003_11065073 | 3300024262 | Deep Subsurface | MPKFIVDLWLDGYETEEEMEEACAEFIYQQLTMTASNVEITQIEEE |
| Ga0210003_11977252 | 3300024262 | Deep Subsurface | MAKFIVELFLDGYESDEDMEDACEEFIYDQLNFSASSVTVERIKHETTDG |
| Ga0244775_115154141 | 3300024346 | Estuarine | MPKFIVDLRLDGYDSEEEMSAACEEFIYDQLNFAGSGVTVTRVNEDNTNDSVDSXLGRCT |
| (restricted) Ga0255049_102567661 | 3300024517 | Seawater | MSKFIVDLYLDGYETEKEMEDACEEFIYDQLNFTASSVKIERIKDPASDRLDPTN |
| (restricted) Ga0255047_100585122 | 3300024520 | Seawater | MSKFIVELYLDGYETEKEMEDACEEFIYDQLNFTASCVKIERIKDPATDIRSADDE |
| Ga0208354_100039426 | 3300025364 | Hypersaline Mat | MPKFIVDLWLDGYETEEEMEEACEEFIYDQLNMTASSVKIQKIEDDE |
| Ga0208102_10232651 | 3300025447 | Freshwater | MMPKFIVELWLDGYESEEEMAAACKEFIYEQLNFSASSVTV |
| Ga0208102_10321474 | 3300025447 | Freshwater | MMPKFIVELWLDGYESEEEMAAACKEFIYEQLNFSASSVTVTEIKENEK |
| Ga0208161_10741602 | 3300025646 | Aqueous | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASYVKIELVDEKDLK |
| Ga0208898_10542762 | 3300025671 | Aqueous | MAKFLVDLWLDGYDTEEEMEEACAEFIYQQLNMTASSVKIEKIEEDEHES |
| Ga0208784_100214413 | 3300025732 | Aqueous | MPKYIVELYLDGYDSEKEMEAACDEFIYEQLNMTASSVKVTKIPDEQAS |
| Ga0208645_10782832 | 3300025853 | Aqueous | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASSVKIKLVDEKDLK |
| Ga0210088_10590401 | 3300025948 | Natural And Restored Wetlands | MKFIVDLWLDGYESDEEMKQACIEFILKQLDFSASSVSVEVYEE |
| Ga0209936_100063913 | 3300026156 | Pond Soil | MAKFLVELWLDGYDNEEEMIEACEEFIYENLNFSASSVEITYLSDEDEKI |
| Ga0209704_10126434 | 3300027693 | Freshwater Sediment | MPKFIVDIWLDGYESEEEMTDACEEFINDQLNFTASSVTVTRVEEGENNE |
| Ga0209492_10638402 | 3300027721 | Freshwater Sediment | MPKFIVDIWLDGYESEEEMTDACEEFIYDQLNFTASSVTVTRVEEGENNE |
| (restricted) Ga0255052_102573941 | 3300027865 | Seawater | MKYVVDLWLDGYESEEEMNAACGEFIFDQLDMTASSVKVERYSR |
| (restricted) Ga0255055_1000080345 | 3300027881 | Seawater | MTKFVIDLWLDGYETEEEHDAACVEFIEDQLNFAGSCITVEKMETNDE |
| (restricted) Ga0255055_100456656 | 3300027881 | Seawater | MTRFVFDYWMDGYDTEEEMIEACKEYIYDQLNFTASGVGKIS |
| Ga0209536_1011043073 | 3300027917 | Marine Sediment | MPKFIVDLWLDGYDTEEEMVDACKEFIYDQLNFSASYVKIELVDEVER |
| Ga0268283_10210653 | 3300028283 | Saline Water | MPRFIVDIWLDGYESEEEMAAACKEFIYEQLDFSASSVTVTEIKEDDAPTT |
| Ga0272412_11321092 | 3300028647 | Activated Sludge | MPKFIVDLWLDGYSTEEEMIEACDEFIYQQLNFTASSVSITYLPEGDSTISSQLPRC |
| Ga0272441_106467862 | 3300028920 | Marine Sediment | MKFIVDLVLDGYESEEEMEEACFEFIYEQLNFTGSGVKIEKYNEEKE |
| Ga0134619_100101912 | 3300029826 | Marine Sediment | MARFIVDLWLDGYDTEEEMIEACEEFIYEQLNFTASSVKIERVEE |
| Ga0307379_115932992 | 3300031565 | Soil | MKTLNKDNDMPKFIVDLWLDGYDTEEKMIEACEEFIYEQLNFTASSVEVKRIEDND |
| Ga0307378_106358762 | 3300031566 | Soil | MAKFEIEIWLDGYDTEEEMEDACFEWIYQQLNFAASRVEIRKIEEKQNVKR |
| Ga0307378_107922562 | 3300031566 | Soil | MPKFIVDLWMDGYDTEEEMEEACEEFIHEQLNFAASYVQIIKIEESEYEKAFKKAFGND |
| Ga0307376_1000746211 | 3300031578 | Soil | MTKFIVDLWLDGYETEEEHDAACEEFIIDQLNFAGSGVSVEKYEFTVEKDE |
| Ga0307375_101668991 | 3300031669 | Soil | MPKFIVGLWMDGYDTEEEMEEACEEFIHEQLNFAASYVQIIKIEESEYEKAFKKAFGND |
| Ga0307375_106090081 | 3300031669 | Soil | FIVDLWLDGYETEEEHDAACEEFIIDQLNFAGSGVSVEKYEFTVEKDE |
| Ga0315907_106478901 | 3300031758 | Freshwater | MPRFIVDIWLDGYDTEEEMIDACEEFIYEQLNFSASNVKIEKIDED |
| Ga0315907_107062472 | 3300031758 | Freshwater | MPKFLVDLWLDGYETEEEMIEACEEFIYEQLNMTASSVQIERIEDTE |
| Ga0315909_103405555 | 3300031857 | Freshwater | MPRFIVDIWLDGYDTEEEMIDACEEFIYEQLNFSASNVKIEKI |
| Ga0315909_109413953 | 3300031857 | Freshwater | MPRFIVDLWLDGYDTEEEMIDACEEFIYEQLNFSASNVKIEKIDED |
| Ga0315284_105312281 | 3300032053 | Sediment | MPKFLVELWLDGYETEEEEEKACEEFIKEQLDFAGTS |
| Ga0315284_106912013 | 3300032053 | Sediment | MPKFIVDLWLDGYETEEEMEDACEEFIYEQLNFSASSVKIERVNE |
| Ga0316192_107042911 | 3300032260 | Worm Burrow | MPRFIVELWMDGYETEKEMEEACEEFIYDQLNFSASSVQI |
| Ga0316189_108034964 | 3300032272 | Worm Burrow | MAKFIVELWLDGYDSEEDMDDACAEFIYEQLSMTASNVEIKEYEE |
| Ga0316193_100944824 | 3300033429 | Sediment | MPRFIVELWMDGYETEKEMEEACEEFIYDQLNFSASSVQIKKIKMSEKPLDKLIVS |
| Ga0316616_1000655247 | 3300033521 | Soil | MPKFIVELWLDGYESEEEMEKACEEFIFDQLDFTATSVTITKLEEKE |
| Ga0334996_0556760_87_230 | 3300033994 | Freshwater | MPKFIVDLWLDGYETEEEMEVACEEFIYEQLTMTASSVKIERIEDTE |
| Ga0335036_0604171_289_435 | 3300034106 | Freshwater | MMPKFLVDLWLDGYETEEEMEAACEEFIYEQLNMTASSVQIERIEDTE |
| ⦗Top⦘ |