


| Basic Information | |
|---|---|
| Family ID | F100986 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MRRKIYEHLISTNVFGIRDKIKQFKKARKRKNEKI |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 25.49 % |
| % of genes near scaffold ends (potentially truncated) | 7.84 % |
| % of genes from short scaffolds (< 2000 bps) | 55.88 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.784 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (36.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.843 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (72.549 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.21% β-sheet: 0.00% Coil/Unstructured: 50.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF04404 | ERF | 26.47 |
| PF14743 | DNA_ligase_OB_2 | 21.57 |
| PF12684 | DUF3799 | 9.80 |
| PF04542 | Sigma70_r2 | 6.86 |
| PF13662 | Toprim_4 | 3.92 |
| PF00856 | SET | 2.94 |
| PF00303 | Thymidylat_synt | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 6.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 6.86 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 6.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 6.86 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.78 % |
| All Organisms | root | All Organisms | 39.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 36.27% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 20.59% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 6.86% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 6.86% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.88% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.92% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 2.94% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.96% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.98% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.98% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 0.98% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.98% |
| Methane Seep | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009492 | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300020235 | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 | Environmental | Open in IMG/M |
| 3300020250 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020259 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556041-ERR599103) | Environmental | Open in IMG/M |
| 3300020279 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX555939-ERR599017) | Environmental | Open in IMG/M |
| 3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021506 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-1-2_MG | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300024265 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025156 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KVRMV2_1000970941 | 3300002231 | Marine Sediment | MRRKIYEHLISTNVFGIRDKIKQFKKARKRKNEKI* |
| KVRMV2_1001064162 | 3300002231 | Marine Sediment | MTRRRKIYEHLIGTNVFGIRDKIKQFKKTRKRKNEKI* |
| KVRMV2_1001131642 | 3300002231 | Marine Sediment | MTRRKIYEHLIGTNVFGIRDKIKAFKKPKKRKNEKV* |
| KVRMV2_1004880542 | 3300002231 | Marine Sediment | MTRRKIYEHLIGTNVFGIRDKIKQFKKARKRKNEKV* |
| Ga0098038_10385224 | 3300006735 | Marine | MRRKLYEHLINTNVFGIRDKIKQFKKARKRKNEKI* |
| Ga0098038_10457012 | 3300006735 | Marine | MRKKIYEHLISTNVFGTRDKIKQFKKSRKKKNEKI* |
| Ga0098038_10909153 | 3300006735 | Marine | MARRKIYEHLIGTNVFGIRDKIKQFKKARKRKNEKI* |
| Ga0098037_10219103 | 3300006737 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKARKRKNEKI* |
| Ga0098037_10249973 | 3300006737 | Marine | MRKKLYEHLIYTNVFGIRDKIKQFKKQRKRKNEKI* |
| Ga0098037_10390521 | 3300006737 | Marine | MRRKLYEHLISTNVFGVRDKIKQFKKQRKRKNEKI* |
| Ga0098054_10462323 | 3300006789 | Marine | MRRKLYEHLINTNVFGIRDKIKQFKKARRKRKNEKI* |
| Ga0098055_10480372 | 3300006793 | Marine | MTRKKIYEHLVGTNVFGIRDKIKQFKKVKKRKNEKI* |
| Ga0070749_100384715 | 3300006802 | Aqueous | MRKKLYEHFISTNVFGIRDKIKQLKKVKRKRNEKI* |
| Ga0070750_100519513 | 3300006916 | Aqueous | MRKKIYEHLISTNVFGIRDKIKQFKKAKRKRNEKI* |
| Ga0070746_100794471 | 3300006919 | Aqueous | INYMRRKLYEHLIYTNVFGIRDKIKQFKKQRKRKNEKI* |
| Ga0098060_100078515 | 3300006921 | Marine | MRRKLYEHLINTNVFNIRDKIKKFKKARKRKNEKI* |
| Ga0098036_10844612 | 3300006929 | Marine | MRKKIYEHLISTNVFGIRDKIKQFKKARRKRNEKI* |
| Ga0098046_10217564 | 3300006990 | Marine | EKMRRKLYEHLINTNVFGIRDKIKQFKKARKRKNEKI* |
| Ga0099849_10506863 | 3300007539 | Aqueous | MRRKLYEHLIYTNVFGIRDKIKQFKKQRKRKNEKI* |
| Ga0114950_101004523 | 3300009030 | Deep Subsurface | MTRRRKIYEHLIGTNVFGIRDKIKAFKKPKKRKNEKV* |
| Ga0114950_107609813 | 3300009030 | Deep Subsurface | MTRRRKIYEHLIGTNVFGIRDKIKQLKKVRKRRNEKI* |
| Ga0114932_100424061 | 3300009481 | Deep Subsurface | MTRRRKIYEHLIGTNVFGIRDKIKKFKKARKRKNEKI* |
| Ga0114932_100521282 | 3300009481 | Deep Subsurface | MTRRKIYEHLIGTNVFGIRDKIKQLKKVRKRRNEKI* |
| Ga0114932_101127611 | 3300009481 | Deep Subsurface | MTRRRKIYEHLIGTNVFGIRDKIKQLKKARKRKNEKI* |
| Ga0114925_100312346 | 3300009488 | Deep Subsurface | MTRRKIYEHLIGTNVFGIRDKIKQLKKGRKKRNEKI* |
| Ga0114925_103366583 | 3300009488 | Deep Subsurface | MRKKLYEHLISTNVFGIRDKIKQFKKARKKKNEKV* |
| Ga0114925_107849692 | 3300009488 | Deep Subsurface | MRRKLYEHLFSTNVFGIRDKIKQLKKGRKKRNEKI* |
| Ga0127412_100370322 | 3300009492 | Methane Seep | MRKKIYEHLISTNVFGIRDKIKQFKKARKKKNEKI* |
| Ga0115013_1000100515 | 3300009550 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKARRKRKNEKI* |
| Ga0115011_100474794 | 3300009593 | Marine | MTRRKIYEHLIGTNAFGIRDKIKQFKKVKKRKNEKI* |
| Ga0115012_100791873 | 3300009790 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKAIRKRKNEKI* |
| Ga0115012_107027332 | 3300009790 | Marine | TRRKIYEHLIGTNVFGIRDKIKQFKKVRKRKNEKI* |
| Ga0098043_10533952 | 3300010148 | Marine | MRRKLYEHLINTNVFGIRDRIKQFKKARRKRKNEKI* |
| Ga0098043_12004711 | 3300010148 | Marine | MRKKLYEHLVSTNVFGIRDKIKQFKKARKKKNEKI* |
| Ga0098056_10410422 | 3300010150 | Marine | MRRKLYEHLINTIVFGIRDKIKQFKKARKRKNEKI* |
| Ga0098059_12010782 | 3300010153 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKVRKKRNEKI* |
| Ga0098059_12928092 | 3300010153 | Marine | MRKKIYEHLISTNVFGIRDKIKQFKKTRKRKNEKI* |
| Ga0136651_100097179 | 3300010330 | Marine Hydrothermal Vent | MRRKLYEHLINTNVFGTRDKIKQFKKVRKKKNEKI* |
| Ga0114934_100782484 | 3300011013 | Deep Subsurface | MTRRKIYEHLIGTNVFGIRDKIKQLKKARKRKNEKI* |
| Ga0114934_102283301 | 3300011013 | Deep Subsurface | MTRKKIYEHLIGTNVFGIRDKIKQFKKARKRRNEKI* |
| Ga0114934_104050931 | 3300011013 | Deep Subsurface | NMRRKLYEHLVSTNVFGIRDKIKQFKKARKKRNEKI* |
| Ga0163110_107453042 | 3300012928 | Surface Seawater | MRKKLYEHLISTNVFGIRDKIKQFKKARKKKNEKI* |
| Ga0163179_1001571910 | 3300012953 | Seawater | MTRRKIYEHLISTNVFGIRDKIKQFKKVRKKRNEKI* |
| Ga0163179_101565334 | 3300012953 | Seawater | MTRRKIYEHLIGTNVFGIRDKIKQFKKARKKRNEKI* |
| Ga0163179_102332341 | 3300012953 | Seawater | MTRRKIYEHLIGTNVFGIRDKIKQLKKARRKRKNEKI* |
| Ga0164320_103255692 | 3300013098 | Marine Sediment | MRKKLYEHLISTNVFGVRDKIKQFKKTRKKKNEKI* |
| Ga0164313_105608301 | 3300013101 | Marine Sediment | EIYYMRRKLYEHLIYTNVFGIRDRIKQFKKQRKKKNEKI* |
| Ga0164321_101197333 | 3300014903 | Marine Sediment | MRKKLYEHLISTNVFGIRDKIKQLKKTRKKRNEKI* |
| Ga0181385_10318004 | 3300017764 | Seawater | MTRKKIYEHLIGTNVFGIRDKIKQLKKARKRKNEKI |
| Ga0181380_10061651 | 3300017782 | Seawater | MRKKIYEHLISTNVFGIRDKIKQFKKQRKRKNEKI |
| Ga0212228_10396583 | 3300020235 | Sediment | MTRRRKIYEHLIGTNVFGIRDKIKAFKKPKKRKNEKV |
| Ga0211627_10293492 | 3300020250 | Marine | MTRRRKIYEHLIGTNVFGIRDKIKQFKKQRKRKNEKI |
| Ga0211529_10285802 | 3300020258 | Marine | MRKKLYEHLVSTNVFGIRDKIKQLKKGRKKRNEKI |
| Ga0211633_10184583 | 3300020259 | Marine | MRRKLYEHLINTNVFGIRDKIKQLKKGRKKRNEKI |
| Ga0211634_10371812 | 3300020279 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKQRKRKNEKI |
| Ga0211522_10087752 | 3300020314 | Marine | MRKKIYEHLISTNVFGIRDKIKQFKKARRKRNEKI |
| Ga0211626_10799072 | 3300020343 | Marine | MTRRKIYEHLIGTNVFGIRDKIKKFKKLRKRKNEKI |
| Ga0211636_100158687 | 3300020400 | Marine | MRRKLYEHLVSTNVFGIRDKIKQLKKGRKKKNEKI |
| Ga0211653_102998072 | 3300020421 | Marine | MRRKLYEHLINTNVFGIRDKIKQFKKARKRKNEKI |
| Ga0211581_100271493 | 3300020429 | Marine | MRRKLYEHLFSTNIFGIRDKIKQLKKGRKKKNEKI |
| Ga0211581_100790123 | 3300020429 | Marine | MRKKLYEHLISTNVFGIRDKIKQFKKARKKKNEKV |
| Ga0211473_101994711 | 3300020451 | Marine | KXLMTRRKIYEHLIGTNVFGIRDKIKQLKKGRKKRNEKI |
| Ga0211545_100200234 | 3300020452 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKGRKRKNEKI |
| Ga0211551_100719043 | 3300020456 | Marine | MRRKLYEHLIYTNVFGIRDKIKQFKKARKRKNEKI |
| Ga0211546_1000204115 | 3300020462 | Marine | MTRRKIYEHLIGTNAFGIRDKIKQFKKVRKRKNEKV |
| Ga0211546_102344882 | 3300020462 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQLKKVRKRRNEKI |
| Ga0211547_101185382 | 3300020474 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQLKKARRKRKNEKI |
| Ga0190358_10107141 | 3300021506 | Hydrothermal Vent Microbial Mat | MRRKLYEHLIYTNVFGIRDKIKQFKKQRKRKNEKI |
| Ga0226832_100186294 | 3300021791 | Hydrothermal Vent Fluids | MTRRKIYEHLIGTNVFGIRDKIKQLKKARKRRNEKI |
| Ga0224509_100416443 | 3300022306 | Sediment | MRKKIYEHLISTNVFGTRDKIKQFKKSRKKKNEKI |
| Ga0209976_104301102 | 3300024265 | Deep Subsurface | MTRRKIYEHLIGTNVFGIRDKIKQLKKGRKKRNEKI |
| Ga0209992_100413424 | 3300024344 | Deep Subsurface | MTRRRKIYEHLIGTNVFGIRDKIKQLKKARKRKNEKI |
| Ga0209977_100438922 | 3300024432 | Deep Subsurface | MRRKLYEHLFSTNVFGIRDKIKQLKKGRKKRNEKI |
| Ga0208667_100142512 | 3300025070 | Marine | MRRKLYEHLISTNVFGVRDKIKQFKKQRKRKNEKI |
| Ga0208157_10125132 | 3300025086 | Marine | MRRKLYEHLINTNVFGIRDKIKQFKKARRKRKNEKI |
| Ga0208157_10138104 | 3300025086 | Marine | MRKKLYEHLIYTNVFGIRDKIKQFKKQRKRKNEKI |
| Ga0208669_100135611 | 3300025099 | Marine | MRRKLYEHLINTNVFNIRDKIKKFKKARKRKNEKI |
| Ga0208158_10028852 | 3300025110 | Marine | MRRKLYEHLINTNVFSIRDKIKKFKKARKRKNEKI |
| Ga0209348_10077593 | 3300025127 | Marine | MRKRIYEHLISTNVFGIRDKIKQLKKGKKKRNEKI |
| Ga0208919_10058845 | 3300025128 | Marine | MRKKIYEHLISTNVFGIRDKIKQFKKTRKRKNEKI |
| Ga0208919_10317972 | 3300025128 | Marine | MRRKLYEHLINTNIFGIRDKIKQFKKVKKRKNEKI |
| Ga0209232_10137453 | 3300025132 | Marine | MRKKIYEHLISTNVFGIRDKIKQFKKARKKRNEKI |
| Ga0209645_10166753 | 3300025151 | Marine | MRKKIYEHLISTNMFGIRDKIKQFKKARKKRNEKI |
| Ga0209645_10243242 | 3300025151 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKARKRKNEKI |
| Ga0209645_10427693 | 3300025151 | Marine | MRKKLYEHLISTNVFGIRDKIKQFKKAKRKRNEKI |
| Ga0209834_100184642 | 3300025156 | Marine Hydrothermal Vent | MRRKLYEHLINTNVFGTRDKIKQFKKVRKKKNEKI |
| Ga0208899_10157843 | 3300025759 | Aqueous | MRKKIYEHLISTNVFGIRDKIKQFKKAKRKRNEKI |
| Ga0208899_10328293 | 3300025759 | Aqueous | MRKKLYEHFISTNVFGIRDKIKQLKKVKRKRNEKI |
| Ga0209503_1000040732 | 3300027859 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKARRKRKNEKI |
| Ga0209404_100083997 | 3300027906 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKVKKRKNEKI |
| Ga0209404_100399813 | 3300027906 | Marine | MTRRKIYEHLIGTNAFGIRDKIKQFKKVKKRKNEKI |
| Ga0209404_100422203 | 3300027906 | Marine | MTRRKIYEHLIGTNVFGIRDKIKQFKKARKRKNEKV |
| Ga0209404_109360792 | 3300027906 | Marine | MRRKIYEHLIYTNVFGIRDKIKQFKKQRKRKNEKI |
| Ga0256382_10110372 | 3300028022 | Seawater | MTRRRKIYEHLIGTNVFGIRDKIKQFKKTRKRKNEKI |
| Ga0256382_11598172 | 3300028022 | Seawater | MTRRRKIYEHLIGTNVFGIRDKIKKFKKARKRKNEKI |
| Ga0256383_1146362 | 3300028448 | Seawater | TRRRKIYEHLIGTNVFGIRDKIKQFKKTRKRKNEKI |
| Ga0183683_10047425 | 3300029309 | Marine | MRRKLYEHLFSTNIFGIRDKIKQLKKGRKKRNEKI |
| Ga0183683_10157443 | 3300029309 | Marine | MRRKLYEHLVSTNVFGIRDKIKQLKKGRKKRNEKI |
| Ga0185543_10049934 | 3300029318 | Marine | MRRKLYEHFMYTDVFGIRTKIKQLKKQRKRKNEKI |
| Ga0183748_10985081 | 3300029319 | Marine | MRRKIYEHLISTNVFGIRDKIKQLKKGKKKRNEKI |
| Ga0183755_10225364 | 3300029448 | Marine | MTRKKIYEHLIGTNVFGIRDKIKQFKKARKRRNEKI |
| Ga0315331_100308622 | 3300031774 | Seawater | MTRRKIYEHLIGTNVFGIRDKIKQLKKARKRKNEKI |
| ⦗Top⦘ |