


| Basic Information | |
|---|---|
| Family ID | F100939 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MYRDKSAMGNRLAPQKGMRDDEEMKRKARERAMMNRLSSMPGKASS |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.33 % |
| % of genes near scaffold ends (potentially truncated) | 23.53 % |
| % of genes from short scaffolds (< 2000 bps) | 57.84 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.157 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.588 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (39.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 0.00% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13482 | RNase_H_2 | 3.92 |
| PF01391 | Collagen | 2.94 |
| PF01612 | DNA_pol_A_exo1 | 1.96 |
| PF01551 | Peptidase_M23 | 1.96 |
| PF00877 | NLPC_P60 | 1.96 |
| PF13481 | AAA_25 | 0.98 |
| PF03237 | Terminase_6N | 0.98 |
| PF00476 | DNA_pol_A | 0.98 |
| PF12705 | PDDEXK_1 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.84 % |
| Unclassified | root | N/A | 42.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10018282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 4173 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10033705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 2775 | Open in IMG/M |
| 3300001335|ML8_10195078 | Not Available | 558 | Open in IMG/M |
| 3300003410|JGI26086J50260_1013219 | All Organisms → Viruses → Predicted Viral | 2910 | Open in IMG/M |
| 3300005613|Ga0074649_1004280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 13289 | Open in IMG/M |
| 3300005909|Ga0075112_1081713 | Not Available | 508 | Open in IMG/M |
| 3300005912|Ga0075109_1038339 | Not Available | 1848 | Open in IMG/M |
| 3300005913|Ga0075108_10016492 | All Organisms → Viruses → Predicted Viral | 2879 | Open in IMG/M |
| 3300005914|Ga0075117_1146378 | Not Available | 679 | Open in IMG/M |
| 3300005914|Ga0075117_1187538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 580 | Open in IMG/M |
| 3300005918|Ga0075116_10121042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 1023 | Open in IMG/M |
| 3300005931|Ga0075119_1048574 | Not Available | 1070 | Open in IMG/M |
| 3300005933|Ga0075118_10244600 | Not Available | 564 | Open in IMG/M |
| 3300005935|Ga0075125_10435705 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006025|Ga0075474_10079252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 1078 | Open in IMG/M |
| 3300006752|Ga0098048_1069741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 1084 | Open in IMG/M |
| 3300006802|Ga0070749_10005193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 8604 | Open in IMG/M |
| 3300006802|Ga0070749_10224382 | Not Available | 1070 | Open in IMG/M |
| 3300006810|Ga0070754_10115019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 1316 | Open in IMG/M |
| 3300006810|Ga0070754_10329752 | Not Available | 679 | Open in IMG/M |
| 3300006916|Ga0070750_10045016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 2152 | Open in IMG/M |
| 3300006919|Ga0070746_10337391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 685 | Open in IMG/M |
| 3300006990|Ga0098046_1004829 | All Organisms → cellular organisms → Bacteria | 4066 | Open in IMG/M |
| 3300007074|Ga0075110_1096320 | Not Available | 624 | Open in IMG/M |
| 3300007276|Ga0070747_1000115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 37763 | Open in IMG/M |
| 3300007516|Ga0105050_10009220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 11117 | Open in IMG/M |
| 3300007516|Ga0105050_10036193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 3857 | Open in IMG/M |
| 3300007516|Ga0105050_10369964 | Not Available | 863 | Open in IMG/M |
| 3300007516|Ga0105050_10419898 | Not Available | 799 | Open in IMG/M |
| 3300007519|Ga0105055_11309955 | Not Available | 500 | Open in IMG/M |
| 3300007538|Ga0099851_1061073 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
| 3300007538|Ga0099851_1164154 | Not Available | 822 | Open in IMG/M |
| 3300007539|Ga0099849_1000698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 15508 | Open in IMG/M |
| 3300007540|Ga0099847_1118122 | Not Available | 800 | Open in IMG/M |
| 3300007609|Ga0102945_1000137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23065 | Open in IMG/M |
| 3300007609|Ga0102945_1004460 | All Organisms → Viruses → Predicted Viral | 3679 | Open in IMG/M |
| 3300007722|Ga0105051_10226560 | Not Available | 1424 | Open in IMG/M |
| 3300009009|Ga0105105_10001740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 9040 | Open in IMG/M |
| 3300009149|Ga0114918_10756551 | Not Available | 507 | Open in IMG/M |
| 3300009469|Ga0127401_1079246 | Not Available | 888 | Open in IMG/M |
| 3300009474|Ga0127390_1175367 | Not Available | 536 | Open in IMG/M |
| 3300010296|Ga0129348_1098704 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300010368|Ga0129324_10353167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 572 | Open in IMG/M |
| 3300010389|Ga0136549_10004744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9832 | Open in IMG/M |
| 3300011188|Ga0136587_1000044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 33717 | Open in IMG/M |
| 3300012990|Ga0159060_1048169 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300013005|Ga0164292_10692068 | Not Available | 651 | Open in IMG/M |
| 3300013010|Ga0129327_10046369 | All Organisms → Viruses → Predicted Viral | 2185 | Open in IMG/M |
| 3300016726|Ga0182045_1394035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 752 | Open in IMG/M |
| 3300017727|Ga0181401_1008066 | Not Available | 3459 | Open in IMG/M |
| 3300017824|Ga0181552_10319985 | Not Available | 760 | Open in IMG/M |
| 3300017987|Ga0180431_10034414 | Not Available | 4819 | Open in IMG/M |
| 3300017991|Ga0180434_10619801 | Not Available | 824 | Open in IMG/M |
| 3300018415|Ga0181559_10236401 | Not Available | 1036 | Open in IMG/M |
| 3300018417|Ga0181558_10323349 | Not Available | 836 | Open in IMG/M |
| 3300020601|Ga0181557_1151117 | Not Available | 948 | Open in IMG/M |
| 3300021347|Ga0213862_10123782 | Not Available | 909 | Open in IMG/M |
| 3300021371|Ga0213863_10237903 | Not Available | 785 | Open in IMG/M |
| 3300022050|Ga0196883_1041411 | Not Available | 560 | Open in IMG/M |
| 3300022053|Ga0212030_1004394 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300022053|Ga0212030_1044792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 625 | Open in IMG/M |
| 3300022200|Ga0196901_1031570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 2063 | Open in IMG/M |
| 3300022821|Ga0222673_1004422 | All Organisms → Viruses → Predicted Viral | 3304 | Open in IMG/M |
| 3300022825|Ga0222669_1000647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 9661 | Open in IMG/M |
| 3300022825|Ga0222669_1009640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 2059 | Open in IMG/M |
| 3300022837|Ga0222711_1028139 | Not Available | 708 | Open in IMG/M |
| 3300022844|Ga0222687_1004545 | All Organisms → Viruses → Predicted Viral | 2879 | Open in IMG/M |
| 3300022848|Ga0222674_1030429 | Not Available | 905 | Open in IMG/M |
| 3300022865|Ga0222668_1001146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 13005 | Open in IMG/M |
| 3300022866|Ga0222651_1006481 | All Organisms → Viruses → Predicted Viral | 3763 | Open in IMG/M |
| 3300022922|Ga0255779_1003893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 14703 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10259149 | Not Available | 763 | Open in IMG/M |
| 3300023245|Ga0222655_1000739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 13143 | Open in IMG/M |
| 3300023256|Ga0222703_1007801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 2256 | Open in IMG/M |
| 3300023295|Ga0222684_1019466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 1312 | Open in IMG/M |
| 3300023709|Ga0232122_1102755 | Not Available | 660 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10140843 | Not Available | 965 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10111351 | Not Available | 1099 | Open in IMG/M |
| 3300025083|Ga0208791_1019606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 1398 | Open in IMG/M |
| 3300025543|Ga0208303_1072715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 778 | Open in IMG/M |
| 3300025608|Ga0209654_1002378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 13042 | Open in IMG/M |
| 3300025617|Ga0209138_1011793 | All Organisms → Viruses → Predicted Viral | 4569 | Open in IMG/M |
| 3300025655|Ga0208795_1050646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 1229 | Open in IMG/M |
| 3300025759|Ga0208899_1034657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 2319 | Open in IMG/M |
| 3300026097|Ga0209953_1000158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 26080 | Open in IMG/M |
| 3300026097|Ga0209953_1037599 | Not Available | 733 | Open in IMG/M |
| 3300027762|Ga0209288_10005063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 3732 | Open in IMG/M |
| 3300027832|Ga0209491_10493897 | Not Available | 806 | Open in IMG/M |
| 3300027832|Ga0209491_10561293 | Not Available | 714 | Open in IMG/M |
| 3300027976|Ga0209702_10007637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 13103 | Open in IMG/M |
| 3300027976|Ga0209702_10007785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 12885 | Open in IMG/M |
| 3300028125|Ga0256368_1003018 | Not Available | 2423 | Open in IMG/M |
| 3300028361|Ga0306872_100095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 38416 | Open in IMG/M |
| 3300031539|Ga0307380_10064176 | All Organisms → Viruses → Predicted Viral | 3951 | Open in IMG/M |
| 3300031566|Ga0307378_11372768 | Not Available | 547 | Open in IMG/M |
| 3300031569|Ga0307489_11212257 | Not Available | 545 | Open in IMG/M |
| 3300031578|Ga0307376_10166710 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
| 3300032435|Ga0335398_10707269 | Not Available | 646 | Open in IMG/M |
| 3300032435|Ga0335398_10743651 | Not Available | 617 | Open in IMG/M |
| 3300033994|Ga0334996_0053109 | All Organisms → Viruses → Predicted Viral | 2502 | Open in IMG/M |
| 3300034374|Ga0348335_002035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 14441 | Open in IMG/M |
| 3300034374|Ga0348335_005184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker | 8139 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 11.76% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 10.78% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 10.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.86% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.92% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.94% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.96% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.96% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.96% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.96% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.98% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.98% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.98% |
| Wetlands Benthic | Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic | 0.98% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.98% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.98% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.98% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001335 | Wetlands benthic microbial communities from British Columbia, Canada - ML8 | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005909 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKF | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300005918 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300005935 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011188 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563 | Environmental | Open in IMG/M |
| 3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300022825 | Saline water microbial communities from Ace Lake, Antarctica - #730 | Environmental | Open in IMG/M |
| 3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
| 3300022844 | Saline water microbial communities from Ace Lake, Antarctica - #1163 | Environmental | Open in IMG/M |
| 3300022848 | Saline water microbial communities from Ace Lake, Antarctica - #866 | Environmental | Open in IMG/M |
| 3300022865 | Saline water microbial communities from Ace Lake, Antarctica - #728 | Environmental | Open in IMG/M |
| 3300022866 | Saline water microbial communities from Ace Lake, Antarctica - #369 | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023245 | Saline water microbial communities from Ace Lake, Antarctica - #423 | Environmental | Open in IMG/M |
| 3300023256 | Saline water microbial communities from Ace Lake, Antarctica - #1506 | Environmental | Open in IMG/M |
| 3300023295 | Saline water microbial communities from Ace Lake, Antarctica - #1075 | Environmental | Open in IMG/M |
| 3300023709 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028361 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498 (v2) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300032435 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100182827 | 3300000101 | Marine | MYRDQSSMGNRLAPQKDAKLADEEMKRKARERAMMNRLSGKPGMASS* |
| DelMOSum2010_100337054 | 3300000101 | Marine | MYRDKSSMGNRLAPQKDSKSTNEDTKKKAREQAMMNRLSGKPGKMSY* |
| ML8_101950783 | 3300001335 | Wetlands Benthic | MYRDKSTMGNRLAPRRGNYQDDEEMKRKARERAMMNRLSSMPGRASS* |
| JGI26086J50260_10132193 | 3300003410 | Marine | MYRDKSSMGNRLAPQKDAKVADEEMKKKARERAMMNRLSSMPGRASS* |
| Ga0074649_10042803 | 3300005613 | Saline Water And Sediment | MYRDKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLSSMPGRASS* |
| Ga0075112_10817132 | 3300005909 | Saline Lake | MYRDKSTMGNRLAPQKNENMSDEEMKRKARERAMMNRLSSMPGKASS* |
| Ga0075109_10383393 | 3300005912 | Saline Lake | MYRDKSSMGNRLAPQKGKVDDEEAKRKARERALMNRLSSAPGKASS* |
| Ga0075108_100164925 | 3300005913 | Saline Lake | MYRDKSAMGNRLAPQKGMRDDEEMKRKARERAMMNRLSSAPGKASS* |
| Ga0075117_11463782 | 3300005914 | Saline Lake | MYRDKSSMGNRLPPQKPKVDDEEMKRKARERALMNRLSSAPGKASS* |
| Ga0075117_11875381 | 3300005914 | Saline Lake | MGNRLAPQKGMRDDEEMKRKARERAMMNRLSSAPGKASS* |
| Ga0075116_101210423 | 3300005918 | Saline Lake | MYRDKSTMGNRLAPQKNENMSDEEMKRKSRERAMMNRLSSMPGKASS* |
| Ga0075119_10485743 | 3300005931 | Saline Lake | MYRDKSTMGNRLAPQKGMRDDEEMKRKARERAMMNRLSSAPGKASS* |
| Ga0075118_102446001 | 3300005933 | Saline Lake | LAPQKGMRDDEEMKRKARERAMMNRLSSAPGKASS* |
| Ga0075125_104357053 | 3300005935 | Saline Lake | APQKGMRDDEEMKRKARERAMMNRLSSAPGKASS* |
| Ga0075474_100792521 | 3300006025 | Aqueous | MYRDKSTMGNRLAPQKSAVMDDEEMKKKARERAMMNRLSSMPGKTSS* |
| Ga0098048_10697414 | 3300006752 | Marine | MYRDKSSMGNRLAPQKDSKVMDEEMKKKARERAMMNRLSSMPGKASS* |
| Ga0070749_100051935 | 3300006802 | Aqueous | MYRNKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLSSMPGRASS* |
| Ga0070749_102243823 | 3300006802 | Aqueous | MYRDKSNMGNRLAPQKGMYEDEEMKRKARERAMMNRLSGKPGMASS* |
| Ga0070754_101150192 | 3300006810 | Aqueous | MYRDKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLSSMPGKASS* |
| Ga0070754_103297522 | 3300006810 | Aqueous | MYRDKSSMGNRLAPQKGMYEDEDMKKKARERAMMNRLSSMPGRASS* |
| Ga0070750_100450162 | 3300006916 | Aqueous | MYRNKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLSSMPGMASS* |
| Ga0070746_103373912 | 3300006919 | Aqueous | MYRDKSSMGNRLASQKGMYDDEDMQKKARERAMMNRLSSMPGKASS* |
| Ga0098046_10048297 | 3300006990 | Marine | MYRDKSSMGNRLPPQKDCKVMDEEMKKKARERAMMNRLSSMPGKASS* |
| Ga0075110_10963201 | 3300007074 | Saline Lake | YRDKSSMGNRLPPQKPKVDDEEMKRKARERALMNRLSSAPGKASS* |
| Ga0070747_100011527 | 3300007276 | Aqueous | MGNRLAPQKDAKLADEEMKRKARERAMMNRLSGKPGMASS* |
| Ga0105050_100092201 | 3300007516 | Freshwater | MYRDTSSMGNRLAPQKAAYGDSEEMKKKARERAMMNRLSSVPGQASS* |
| Ga0105050_100361936 | 3300007516 | Freshwater | MYRDKSTMGNRLAPQKSNYDNEDMKKKARERAMMNRLSSMPGKASS* |
| Ga0105050_103699641 | 3300007516 | Freshwater | NWIMYRDKSTMGNRLAPQKSNYDNEDMKKKARERAMMNRLSSMPGKASS* |
| Ga0105050_104198982 | 3300007516 | Freshwater | MGNRLAPQKPKVDDEEAKRKARERALMNRLSSAPGKASS* |
| Ga0105055_113099552 | 3300007519 | Freshwater | MTYRTPSTQGNRLAPQKGKRDEEEAKRKARARALANRLSSKPGKSSS* |
| Ga0099851_10610732 | 3300007538 | Aqueous | MYRDKSSMGNRLAPQKGMYEDEDMQKKARERAMMNRLSSMPGRASS* |
| Ga0099851_11641542 | 3300007538 | Aqueous | MYRDQSSMGNRLAPQKDAKVMDEEMKRKARERAMMNRLSSKPGMASS* |
| Ga0099849_100069819 | 3300007539 | Aqueous | MYRDKSTMGNRLAPQKGKYQDEEMKKKARERAMMNRLSSMPGKTSS* |
| Ga0099847_11181223 | 3300007540 | Aqueous | MYRDKSATGNRLAPQKGMYDDEEMKKKARERAMMNRLSSMPGKASS* |
| Ga0102945_100013719 | 3300007609 | Pond Water | MYRDKSSMGNRLAPQKGKYEDEEMKKKARERAMMNRLSSMPGRASS* |
| Ga0102945_10044605 | 3300007609 | Pond Water | MYRDKSSMGNRLAPQKGKFQDDEEMQKKARERAMMNRLSSMPGKASS* |
| Ga0105051_102265603 | 3300007722 | Freshwater | RLMYRDTSSMGNRLAPQKAAYGDSEEMKKKARERAMMNRLSSVPGQASS* |
| Ga0105105_1000174012 | 3300009009 | Freshwater Sediment | MYRDASSMGNRLAPQRNKYQEDKEMQKKARERAMMNRLSSMPGKASS* |
| Ga0114918_107565512 | 3300009149 | Deep Subsurface | MYRDQSSMGNRLAPQKDAKVMDEEMKRKARERAMMNRLSGKPGMASS* |
| Ga0127401_10792461 | 3300009469 | Meromictic Pond | MYRDQSSMGNRLAPQKDAKVMDEEMKCKARERAMMNRLSSKPGMASS* |
| Ga0127390_11753672 | 3300009474 | Meromictic Pond | MGNRLAPQKDAKVMDEEMKRKARERAMMNRLSGKPGMASS* |
| Ga0129348_10987043 | 3300010296 | Freshwater To Marine Saline Gradient | MGNRLAPQKGKYQDEEMKKKARERAMMNRLSSMPGKTSS* |
| Ga0129324_103531673 | 3300010368 | Freshwater To Marine Saline Gradient | MYRDKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLS |
| Ga0136549_100047449 | 3300010389 | Marine Methane Seep Sediment | MYRDKSSMGNRLAPQKGKYEDDEMQKKARERAMMNRLSSMPGRASS* |
| Ga0136587_100004427 | 3300011188 | Saline Lake | MYRTPGTQGNRLAPQKNENMSDEERKRKAREEAMMRRLSSAPGKTSSGMY* |
| Ga0159060_10481693 | 3300012990 | Hydrocarbon Resource Environments | MYRDKSTMGNRLATPKPRYEDDEEMKRIARERAMMNRLSSMPGKASS* |
| Ga0164292_106920683 | 3300013005 | Freshwater | MYRDASSMGNRLAPQRNKYQDDKEMQKKARERAMMNRLSSMP |
| Ga0129327_100463694 | 3300013010 | Freshwater To Marine Saline Gradient | MYRDKSSMGNRLAPQKGMYDDEDMQKKARERAMINRLSSMPGKASS* |
| Ga0182045_13940351 | 3300016726 | Salt Marsh | MYRDKSTMGNRLAPQKNAVMDDEEMKKKARERAMINRLSSM |
| Ga0181401_10080665 | 3300017727 | Seawater | MYRDKSSMGNRLAPQKDSKSTNEDTKKKAREQAMMNRLSGKPGKMSY |
| Ga0181552_103199851 | 3300017824 | Salt Marsh | MYRDKSTMGNRLAPQKSVVMDDEEMKKKARERAMINRLSSMPGKTSS |
| Ga0180431_100344145 | 3300017987 | Hypersaline Lake Sediment | MYRDSSNMGNRLAPQKGKYQDDEEMKKKARERAMMNRLSSMPGRASS |
| Ga0180434_106198012 | 3300017991 | Hypersaline Lake Sediment | MYRDKASMGNRLAPQKGVYDDEEMKKKARERAMMNRLSSMPGRASS |
| Ga0181559_102364011 | 3300018415 | Salt Marsh | ETFIMYRDKSTMGNRLAPQKSAMMDDEEMKKKARERAMINRLSSMPGKTSS |
| Ga0181558_103233491 | 3300018417 | Salt Marsh | RLAPQKNAVMDDEEMKKKARERAMINRLSSMPGKTSS |
| Ga0181557_11511173 | 3300020601 | Salt Marsh | YRDKSTMGNRLAPQKNAVMDDEEMKKKARERAMINRLSSMPGKTSS |
| Ga0213862_101237823 | 3300021347 | Seawater | MYRDKSTMGNRLAPQKNAVMDDEEMKKKARERAMINRLSSMPGKTSS |
| Ga0213863_102379034 | 3300021371 | Seawater | MYRDKSTMGNRLAPQKSAVMDDEEMKKKARERAMMNRLSSMPGKTSS |
| Ga0196883_10414112 | 3300022050 | Aqueous | MYRDQSSMGNRLAPQKDAKLADEEMKRKARERAMMNRLSGKPGMASS |
| Ga0212030_10043943 | 3300022053 | Aqueous | MYRDKSSMGNRLAPQKGMYEDEDMQKKARERAMMNRLSSMPGRASS |
| Ga0212030_10447922 | 3300022053 | Aqueous | MYRDKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLSSMPGKASS |
| Ga0196901_10315703 | 3300022200 | Aqueous | MYRDQSSMGNRLAPQKDAKVMDEEMKRKARERAMMNRLSSKPGMASS |
| Ga0222673_10044226 | 3300022821 | Saline Water | MYRDKSAMGNRLAPQKGMRDDEEMKRKARERAMMNRLSSAPGKASS |
| Ga0222669_10006479 | 3300022825 | Saline Water | MYRDKSSMGNRLAPQKPKVDDEEAKRKARERALMNRLSSAPGKASS |
| Ga0222669_10096402 | 3300022825 | Saline Water | MYRDKSTMGNRLAPQKNENMSDEEMKRKARERAMMNRLSSAPGKTSSAPGKTSSGMY |
| Ga0222711_10281392 | 3300022837 | Saline Water | NRLPPQKPKVDDEEMKRKARERALMNRLSSAPGKASS |
| Ga0222687_10045455 | 3300022844 | Saline Water | MYRDKSTMGNRLAPQKNENMSDEEMKRKARERAMMNRL |
| Ga0222674_10304293 | 3300022848 | Saline Water | MYRDKSTMGNRLAPQKNENMSDEEMKRKARERAMMNRLSSTPGKTSSGMY |
| Ga0222668_100114611 | 3300022865 | Saline Water | ERCFDEENRLMYRDKSSMGNRLAPQKPKVDDEEAKRKARERALMNRLSSAPGKASS |
| Ga0222651_10064814 | 3300022866 | Saline Water | GNRLAPQKGKVDDEEAKRKARERALMNRLSSAPGKASS |
| Ga0255779_10038931 | 3300022922 | Salt Marsh | TFIMYRDKSTMGNRLAPQKNAVMDDEEMKKKARERAMINRLSSMPGKTSS |
| (restricted) Ga0233412_102591492 | 3300023210 | Seawater | MYRNQSSMGNRLAPQKDAKAMDEEMKRKARERAMMNRLSSKPGMASS |
| Ga0222655_10007391 | 3300023245 | Saline Water | ERCFDEENRLMYRDKSSMGNRLAPQKGKVDDEEAKRKARERALMNRLSSAPGKASS |
| Ga0222703_10078011 | 3300023256 | Saline Water | MYRDKSTMGNRLAPQKGMRDDEEMKRKARERAMMNRL |
| Ga0222684_10194661 | 3300023295 | Saline Water | MYRDKSAMGNRLAPQKGMRDDEEMKRKARERAMMNRLSSMPGKASS |
| Ga0232122_11027553 | 3300023709 | Salt Marsh | MYRDKSTMGNRLAPQKSVVMDDEEMKKKARERAMINRLSSM |
| (restricted) Ga0255040_101408433 | 3300024059 | Seawater | MYRDQSSMGNRLAPQKDAKAMDEEMKRKARERAMMNRLSSKPGMASS |
| (restricted) Ga0255039_101113513 | 3300024062 | Seawater | DEETFIMYRDQSSMGNRLAPQKDAKAMDEEMKRKARERAMMNRLSSKPGMASS |
| Ga0208791_10196061 | 3300025083 | Marine | MYRDKSSMGNRLAPQKDSKVMDEEMKKKARERAMMNRLSSMPGKASS |
| Ga0208303_10727153 | 3300025543 | Aqueous | MYRDKSSMGNRLAPQKGMYDDEDMQKKARERAMINRLSSMPGKASS |
| Ga0209654_10023784 | 3300025608 | Marine | MGNRLAPQKDAKVADEEMKKKARERAVMNRLSSMPGRASS |
| Ga0209138_10117933 | 3300025617 | Marine | MYRDKSSMGNRLAPQKDAKVADEEMKKKARERAMMNRLSSMPGRASS |
| Ga0208795_10506464 | 3300025655 | Aqueous | MYRDKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLSS |
| Ga0208899_10346574 | 3300025759 | Aqueous | MYRNKSSMGNRLAPQKGMYDDEDMQKKARERAMMNRLSSMPGRASS |
| Ga0209953_100015823 | 3300026097 | Pond Water | MYRDKSSMGNRLAPQKGKYEDEEMKKKARERAMMNRLSSMPGRASS |
| Ga0209953_10375993 | 3300026097 | Pond Water | MYRDKSSMGNRLAPQKGKFQDDEEMQKKARERAMMNRLSSMPGKASS |
| Ga0209288_100050633 | 3300027762 | Freshwater Sediment | MYRDSSSMGNRLAPQRNKYQEDKEMQKKARERAMMNRLSSMPGKASS |
| Ga0209491_104938972 | 3300027832 | Freshwater | MYRDKSSMGNRLAPQKPKVDDEEAKRKARERALMNRLSSVPGKASS |
| Ga0209491_105612932 | 3300027832 | Freshwater | MTYRTPSTQGNRLAPQKGKRDEEEAKRKARARALANRLSSKPGKSSS |
| Ga0209702_1000763718 | 3300027976 | Freshwater | MYRDTSSMGNRLAPQKAAYGDSEEMKKKARERAMMNRLSSVPGQASS |
| Ga0209702_1000778517 | 3300027976 | Freshwater | MYRDKSTMGNRLAPQKSNYDNEDMKKKARERAMMNRLSSMPGKASS |
| Ga0256368_10030183 | 3300028125 | Sea-Ice Brine | MYRDKSSMGNRLAPQKDSKSINEDAKKKAREQAMMNRLSGKPGKMSS |
| Ga0306872_10009516 | 3300028361 | Saline Lake | MYRTPGTQGNRLAPQKNENMSDEERKRKAREEAMMRRLSSAPGKTSSGMY |
| Ga0307380_100641762 | 3300031539 | Soil | MYRDKSTMGNRLAPQKSAVMDDEEMKKKARERAMINRLSSMPGKTSS |
| Ga0307378_113727681 | 3300031566 | Soil | MYRDKSSMGNRLAPQKGNYEDDEMKKKARERAMMNRLSSMPGKASS |
| Ga0307489_112122571 | 3300031569 | Sackhole Brine | MYRDKSSMGNRLAPQKDSKSMNEDTKKKAREQAMMNRLSGKPGKMSS |
| Ga0307376_101667103 | 3300031578 | Soil | MYRDKSAMGNRLAPQKGMYEDEDMKKKARERAMMNRLSSMPGRASS |
| Ga0335398_107072691 | 3300032435 | Freshwater | ERCFDEENRLMYRDKSSMGNRLAPQKPKVDDEEAKRKARERALANRLSSRPGKSSS |
| Ga0335398_107436511 | 3300032435 | Freshwater | MTYRTPSTQGNRLAPQKGKRDEEEAKRKARERALMNRLSSVPGKASS |
| Ga0334996_0053109_322_444 | 3300033994 | Freshwater | MGNRLAPQRNKYQEDKEMQKKARERAMMNRLSSMPGKASS |
| Ga0348335_002035_10125_10247 | 3300034374 | Aqueous | MGNRLAPQKSAVMDDEEMKKKARERAMMNRLSSMPGKTSS |
| Ga0348335_005184_4108_4230 | 3300034374 | Aqueous | MGNRLAPQKDAKLADEEMKRKARERAMMNRLSGKPGMASS |
| ⦗Top⦘ |