


| Basic Information | |
|---|---|
| Family ID | F100799 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKKKKATTKSAARKPAAKKPAGQRQAKTYTPKPLQGNGRAPFRYPPQ |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 31.37 % |
| % of genes from short scaffolds (< 2000 bps) | 75.49 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.314 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.392 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.235 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00990 | GGDEF | 16.67 |
| PF06224 | HTH_42 | 7.84 |
| PF01243 | Putative_PNPOx | 3.92 |
| PF00202 | Aminotran_3 | 1.96 |
| PF02627 | CMD | 1.96 |
| PF05593 | RHS_repeat | 1.96 |
| PF06723 | MreB_Mbl | 1.96 |
| PF03916 | NrfD | 0.98 |
| PF00589 | Phage_integrase | 0.98 |
| PF13247 | Fer4_11 | 0.98 |
| PF13592 | HTH_33 | 0.98 |
| PF02867 | Ribonuc_red_lgC | 0.98 |
| PF05742 | TANGO2 | 0.98 |
| PF01042 | Ribonuc_L-PSP | 0.98 |
| PF00561 | Abhydrolase_1 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 7.84 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.96 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 1.96 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.96 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 1.96 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.98 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.98 |
| COG3332 | Uncharacterized stress-responsive protein, TANGO2 (Transport and Golgi organisation 2) family, contains NRDE motif | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.31 % |
| Unclassified | root | N/A | 15.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_5691_length_1018_cov_7.628684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1050 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101945374 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300000443|F12B_11778193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300000956|JGI10216J12902_105951510 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300002561|JGI25384J37096_10090118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1092 | Open in IMG/M |
| 3300004267|Ga0066396_10073572 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005093|Ga0062594_101116137 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005172|Ga0066683_10200156 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300005186|Ga0066676_10110865 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300005289|Ga0065704_10794571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
| 3300005355|Ga0070671_101501393 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 596 | Open in IMG/M |
| 3300005363|Ga0008090_15398369 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1184 | Open in IMG/M |
| 3300005446|Ga0066686_10853648 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005451|Ga0066681_10062919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2056 | Open in IMG/M |
| 3300005540|Ga0066697_10061004 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300005568|Ga0066703_10657974 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005764|Ga0066903_101679202 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300006032|Ga0066696_10104985 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300006034|Ga0066656_10832262 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300006796|Ga0066665_10222670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1478 | Open in IMG/M |
| 3300006871|Ga0075434_100404425 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1386 | Open in IMG/M |
| 3300007255|Ga0099791_10108773 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300007255|Ga0099791_10553396 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300009012|Ga0066710_100081547 | All Organisms → cellular organisms → Bacteria | 4220 | Open in IMG/M |
| 3300009038|Ga0099829_10166131 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300009038|Ga0099829_11139625 | Not Available | 646 | Open in IMG/M |
| 3300009088|Ga0099830_10097892 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300009088|Ga0099830_10293565 | Not Available | 1296 | Open in IMG/M |
| 3300009089|Ga0099828_11336189 | Not Available | 634 | Open in IMG/M |
| 3300009089|Ga0099828_11361702 | Not Available | 627 | Open in IMG/M |
| 3300009137|Ga0066709_102643475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 671 | Open in IMG/M |
| 3300009795|Ga0105059_1058249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300009815|Ga0105070_1069556 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010336|Ga0134071_10173796 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300010360|Ga0126372_10362897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1305 | Open in IMG/M |
| 3300010360|Ga0126372_10575727 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300010362|Ga0126377_10362607 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300010376|Ga0126381_102499069 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010868|Ga0124844_1021502 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300012189|Ga0137388_10960887 | Not Available | 789 | Open in IMG/M |
| 3300012200|Ga0137382_10793807 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012202|Ga0137363_11074989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
| 3300012203|Ga0137399_10202910 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300012203|Ga0137399_11419702 | Not Available | 580 | Open in IMG/M |
| 3300012205|Ga0137362_10005859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8521 | Open in IMG/M |
| 3300012207|Ga0137381_10224684 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300012208|Ga0137376_10982600 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012349|Ga0137387_10904416 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012361|Ga0137360_10234951 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1499 | Open in IMG/M |
| 3300012362|Ga0137361_10280589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1523 | Open in IMG/M |
| 3300012685|Ga0137397_10552207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 857 | Open in IMG/M |
| 3300012685|Ga0137397_10710895 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 746 | Open in IMG/M |
| 3300012922|Ga0137394_10078970 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2753 | Open in IMG/M |
| 3300012927|Ga0137416_10674282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 906 | Open in IMG/M |
| 3300012930|Ga0137407_10097108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2517 | Open in IMG/M |
| 3300012944|Ga0137410_11741904 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 549 | Open in IMG/M |
| 3300015245|Ga0137409_10581202 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300015357|Ga0134072_10155230 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300015371|Ga0132258_10005574 | All Organisms → cellular organisms → Bacteria | 24725 | Open in IMG/M |
| 3300015373|Ga0132257_100241042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2156 | Open in IMG/M |
| 3300017659|Ga0134083_10112949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1079 | Open in IMG/M |
| 3300017944|Ga0187786_10309387 | Not Available | 651 | Open in IMG/M |
| 3300017947|Ga0187785_10578927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300018063|Ga0184637_10204966 | Not Available | 1209 | Open in IMG/M |
| 3300018074|Ga0184640_10199303 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300018077|Ga0184633_10032877 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300018082|Ga0184639_10031753 | Not Available | 2694 | Open in IMG/M |
| 3300018431|Ga0066655_10032924 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2541 | Open in IMG/M |
| 3300018482|Ga0066669_10321405 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300019789|Ga0137408_1207354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1614 | Open in IMG/M |
| 3300021073|Ga0210378_10022700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2529 | Open in IMG/M |
| 3300025940|Ga0207691_11450981 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300026296|Ga0209235_1218375 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026325|Ga0209152_10003646 | All Organisms → cellular organisms → Bacteria | 5761 | Open in IMG/M |
| 3300026326|Ga0209801_1363002 | Not Available | 510 | Open in IMG/M |
| 3300026351|Ga0257170_1014155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300026354|Ga0257180_1049461 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026480|Ga0257177_1016100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300027169|Ga0209897_1051199 | Not Available | 604 | Open in IMG/M |
| 3300027187|Ga0209869_1035800 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027324|Ga0209845_1018870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1133 | Open in IMG/M |
| 3300027846|Ga0209180_10005480 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 6403 | Open in IMG/M |
| 3300027875|Ga0209283_10754131 | Not Available | 603 | Open in IMG/M |
| 3300027961|Ga0209853_1008813 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3121 | Open in IMG/M |
| 3300028536|Ga0137415_10329576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1330 | Open in IMG/M |
| 3300028536|Ga0137415_11154181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300031538|Ga0310888_10074980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1658 | Open in IMG/M |
| 3300031682|Ga0318560_10721940 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031720|Ga0307469_10083876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2170 | Open in IMG/M |
| 3300031740|Ga0307468_101474294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 629 | Open in IMG/M |
| 3300032089|Ga0318525_10028657 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
| 3300032180|Ga0307471_100188688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2045 | Open in IMG/M |
| 3300032211|Ga0310896_10268240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 870 | Open in IMG/M |
| 3300033811|Ga0364924_047221 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300033812|Ga0364926_085006 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300034114|Ga0364938_048194 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300034354|Ga0364943_0235905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 680 | Open in IMG/M |
| 3300034417|Ga0364941_007124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2000 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.88% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 4.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027187 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_02067770 | 2140918013 | Soil | MKKKKSSKTAARKPAAKKPAARRQTAATYTPKPVQGDGWAPFRYPPQ |
| INPhiseqgaiiFebDRAFT_1019453742 | 3300000364 | Soil | MKKKKXTPKAAARKXAGKKXAAPKQAKSGXXXTPKPXQGNGWAPFRYPPX* |
| F12B_117781932 | 3300000443 | Soil | MKKKRSTPKAAARKGAGKKSAAPKQAKSGASCTPKPLQGNGWAPFRYPPQ* |
| JGI10216J12902_1059515101 | 3300000956 | Soil | AARKGAGKKSAAPKQAKSGASYTPKPLQGNGWAPFRYPPQ* |
| JGI25384J37096_100901181 | 3300002561 | Grasslands Soil | MKKKKARTKSAARKPTAKKPAAQRQAVTYTPKPMQGNGWAPFR |
| Ga0066396_100735721 | 3300004267 | Tropical Forest Soil | MKKKKSSKTAARKPAAKKPVARRQAAATYTPKPVQGDGWAPFRYPPQ* |
| Ga0062594_1011161372 | 3300005093 | Soil | MKKKKSSKTAARKPAAKKPAARRQTAATYTPKPVQGDGWAPFRYPPQ* |
| Ga0066683_102001561 | 3300005172 | Soil | KKKKKAATKSAARKTASRKPAAAKSAATYTPKPVGGTGWAPFRYPPQ* |
| Ga0066676_101108652 | 3300005186 | Soil | MKKKKSAKTAARKPAAKKPAAQRQATTYTPKPVRGDGWAPFRYPPQ* |
| Ga0065704_107945712 | 3300005289 | Switchgrass Rhizosphere | MKKKKSSKTAARKPAAKKPAARRQTAATYTPKPVQGDGWAP |
| Ga0070671_1015013932 | 3300005355 | Switchgrass Rhizosphere | MKKKKATKAASRKRAGQKPAAPKQAKSAGTYTPKPVQGNGWAPFRYPPQ* |
| Ga0008090_153983691 | 3300005363 | Tropical Rainforest Soil | MTKKKATKAASRKRADKKPAVPKQAKSAGTYTPKPLQGNGWAPFRYPPQ* |
| Ga0066686_108536481 | 3300005446 | Soil | MKKKKKAATKAAQKTASRKPAAAKNAATYTPKPVGGTGWAPFRYPPQ* |
| Ga0066681_100629194 | 3300005451 | Soil | MKKKKKAATKSAARKTASRKPAAAKSAPTYTPKPVGGTGWAPFRYPPQ* |
| Ga0066697_100610042 | 3300005540 | Soil | MKKKKKAATKSAARKTASRKPAAAKSAATYTPKPVGGTGWAPFRYPPQ* |
| Ga0066703_106579742 | 3300005568 | Soil | MKKKKSTPKAAARKRAGQKSAAPKQAKSAASYTPKPVQGNGWAP |
| Ga0066903_1016792022 | 3300005764 | Tropical Forest Soil | MKKKKSSKTAARKPAAKKPAARRQAAATYTPKPVQGDGWAPFRYPPQ* |
| Ga0066696_101049853 | 3300006032 | Soil | KAAARKRAGKKPAAPKPASSAATYTPKPLQGNGWAPFRYPPQ* |
| Ga0066656_108322622 | 3300006034 | Soil | MKKKKARTKSAARKPTAKKPAAQRQAVTYTPKPMQGNG |
| Ga0066665_102226703 | 3300006796 | Soil | MKKKKSTPKAAARKRAGQKSAAPKQAKSAASYTPKPVQGNGWARFRYPPQ* |
| Ga0075434_1004044253 | 3300006871 | Populus Rhizosphere | MKKKKATKAASRKRAGQKPAAPKQAKSAGTYTPKPLQGNGWAPFRYPPQ* |
| Ga0099791_101087732 | 3300007255 | Vadose Zone Soil | MKKKKKTTAKSAARKTASRKPAAKTAATYTPKPVGGTGWAPFRYPPQ* |
| Ga0099791_105533961 | 3300007255 | Vadose Zone Soil | MKKKKATPKAAARKRAGKKPAAPKPAKSAATYTPKPLQGNGWA |
| Ga0066710_1000815473 | 3300009012 | Grasslands Soil | MKKKKKAATKAARKTASRKPAAAKNAATYTPKPVGGTGWAPFRYPPQ |
| Ga0099829_101661312 | 3300009038 | Vadose Zone Soil | MKKKKATTKSAARKPAAKKPAGQRQTKTYTPKSLQGNGRAPFRYPPQ* |
| Ga0099829_111396252 | 3300009038 | Vadose Zone Soil | MKKKKATTKSAARKPAAKKPAGQRQAKTYTPKPLQGNGRTPFRYPPQ* |
| Ga0099830_100978923 | 3300009088 | Vadose Zone Soil | MKKKKATTKSAARKPAAKKPAGQRQAKTYTPKPLQGNGRAPFRYPPQ* |
| Ga0099830_102935653 | 3300009088 | Vadose Zone Soil | MMKKKATTKSAARKPAGERQAKTYTPKPLQGNGRAPFR |
| Ga0099828_113361891 | 3300009089 | Vadose Zone Soil | MKKKKATTKSVARKPAGERQAKTYTPKPLQGNGRAPFRYPPQ* |
| Ga0099828_113617022 | 3300009089 | Vadose Zone Soil | MKKKKATTKSAARKPAAKKPAGQRQATTYTPKSLQGNGRAPFRYPPQ* |
| Ga0066709_1026434751 | 3300009137 | Grasslands Soil | MKKKKSTTKAAAPKRAGKKSAVPKQAKSAASYTPKPVQGNGWAPFRYPPQ* |
| Ga0105059_10582492 | 3300009795 | Groundwater Sand | MKKKKPTTKSAARKAAAKKPPAKRQGVAYTPKPLQGDGWAPFRYPPQ* |
| Ga0105070_10695562 | 3300009815 | Groundwater Sand | MKKKKATIKSAARKPAAKKPAGQRQARTYTPKPLQGNGRAPFRYPPQ* |
| Ga0134071_101737961 | 3300010336 | Grasslands Soil | KAAARKRAGQKSAAPKQAKSAASYTPKPVQGNGWAPFRYPPQ* |
| Ga0126372_103628971 | 3300010360 | Tropical Forest Soil | RMKKKKSSKTAARKPAAKKPVARRQAAATYTPKPVQGDGWAPFRYPPQ* |
| Ga0126372_105757272 | 3300010360 | Tropical Forest Soil | MTKKKATKAASRKRAGQKPAAPKQAKSAGTYTPKPLQGNGWAPFRYPPQ* |
| Ga0126377_103626071 | 3300010362 | Tropical Forest Soil | AAARKRAGKKPASPKPAKSAATYTPKPVQGNGWAPFRYPPQ* |
| Ga0126381_1024990691 | 3300010376 | Tropical Forest Soil | MKKKKVTPKGAARKRAGKKPAQPKPAKSAATYTPKPLQGNGWAPFRYPPQ* |
| Ga0124844_10215023 | 3300010868 | Tropical Forest Soil | KKKSSKTAARKPAAKKPVARRQAAATYTPKPVQGDGWAPFRYPPQ* |
| Ga0137388_109608871 | 3300012189 | Vadose Zone Soil | MKKKKKATTKSVARKPAGERQAKTYTPKPLQGNGRAPFRYPPQ* |
| Ga0137382_107938072 | 3300012200 | Vadose Zone Soil | STTKAAARKRAGKKSAVPKQAKSAASYTPKPVQGNGWAPFRYPPQ* |
| Ga0137363_110749891 | 3300012202 | Vadose Zone Soil | MKKKKSTPKAAARKRAGQKSAAPKQAKSAASYTPKPVQGNGWAPF |
| Ga0137399_102029101 | 3300012203 | Vadose Zone Soil | KKARTFFAARKPTTKKPAAQRQAVTYTPKPMQGNGWAPFRYPPQ* |
| Ga0137399_114197021 | 3300012203 | Vadose Zone Soil | KSTTKAAVRKRAGKKSAAPKQAKSAASYTPKPVQGNGWAPFRYPPQ* |
| Ga0137362_100058592 | 3300012205 | Vadose Zone Soil | MKKKKSTPKAAARKRAGRKPAAPKQAKSAASYTPKPVQGNGWAPFRYPPQ* |
| Ga0137381_102246842 | 3300012207 | Vadose Zone Soil | MKKKKKATTKSAARKTASRKPAAAKSAPTYTPKPVGGTGWAPFRYPPQ* |
| Ga0137376_109826002 | 3300012208 | Vadose Zone Soil | MKKKKKAATKSAARKTASRKPAAAKSAATYTPKPVGSTGWAPFRYPPQ* |
| Ga0137387_109044161 | 3300012349 | Vadose Zone Soil | MKKKKKAATKSASRKTASRKPAAAKSAPTYTPKPVGGTGWAPFRYPPQ* |
| Ga0137360_102349512 | 3300012361 | Vadose Zone Soil | MKKKKSTTKAAARKRAGRKPAAPKQAKSAASYTPKPVQGNGWAPFRYPPQ* |
| Ga0137361_102805892 | 3300012362 | Vadose Zone Soil | MKKKKKTAAKSAVRKTASRKPAAKTAATYTPKPVGGTGWAPFRYPPQ* |
| Ga0137397_105522072 | 3300012685 | Vadose Zone Soil | MKKKKSTTKAAARKRAGKKPAAPKQARSAGSYTPKPVEGNGWAPFRYPPQ* |
| Ga0137397_107108952 | 3300012685 | Vadose Zone Soil | MKKKKATKAAAPKRAGKKPAAPKQAKSGGTYTPKPVQGNGWAPFRY |
| Ga0137394_100789702 | 3300012922 | Vadose Zone Soil | MKKKKKAAAKSAARKTASRKPAAAKTAATYTPKPVGGTGWAPFRYPPQ* |
| Ga0137416_106742822 | 3300012927 | Vadose Zone Soil | MKKKKKAAAKSAARKTVSRKPAAAKTAATYTPKPVGGTGWAPFRYPPQ* |
| Ga0137407_100971082 | 3300012930 | Vadose Zone Soil | MKKKKSTTKAAARKRAGRKPAAPKQVKSAASYTPKPVQGNGWAPFRYPPQ* |
| Ga0137410_117419042 | 3300012944 | Vadose Zone Soil | MKKKKATTKSAARNRAGKKPAAQKKTTTYTPKPLQGNGWAPFRYPPQ* |
| Ga0137409_105812021 | 3300015245 | Vadose Zone Soil | KKKKATTKSAARNRAGKKPAAQKKTTTYTPKPLQGNGWAPFRYPPQ* |
| Ga0134072_101552302 | 3300015357 | Grasslands Soil | MKKKKSTPKAAARKRAGQKSAAPKQAKSAASYTPKPVQGNGWAPFRYTPQ* |
| Ga0132258_100055747 | 3300015371 | Arabidopsis Rhizosphere | MKKKKSSKTAARKTAAKKPAARRQAAATYTPKPVQGDGWAPFRYPPQ* |
| Ga0132257_1002410422 | 3300015373 | Arabidopsis Rhizosphere | MKKKKATKAASRKRAGQKPAAPKQAKPAGTYTPKPLQGNGWGPLRYPPQ* |
| Ga0134083_101129492 | 3300017659 | Grasslands Soil | MNKKKSAKTAARKPAAKKPAAQRQATTYTPKPVRGDGWAPFRYPPQ |
| Ga0187786_103093871 | 3300017944 | Tropical Peatland | MKKKKATKAAARKPAGKRPTAPKQAKSAGTYTPKPLQGNGWAPFRYPPQ |
| Ga0187785_105789272 | 3300017947 | Tropical Peatland | MKKKKATKAAVRKPAGKKPTAPKQAKSAGTYTPKPLQGNGWAPFRYPPQ |
| Ga0184637_102049662 | 3300018063 | Groundwater Sediment | MKKKKATTKSAARKPAAKKPAGQRQAKTYTPKPLLGNGRAPFRYPPQ |
| Ga0184640_101993032 | 3300018074 | Groundwater Sediment | MKKKKATTKSAARKPAPKKPAGQRQTKTYTPKPLQGNGRAPFRYPPQ |
| Ga0184633_100328776 | 3300018077 | Groundwater Sediment | MKKKATTKSAARKPAPKKPAGQRQAKTYTPKPLQGNGRAPFRYPPQ |
| Ga0184639_100317531 | 3300018082 | Groundwater Sediment | MKKKKATTKSAARKPAPKKPAGQRQAKTYTPKPLQGNGRAP |
| Ga0066655_100329244 | 3300018431 | Grasslands Soil | MKKKKKAATKSAARKTASRKPAAAKSAATYTPKPVGGTGWAPFRYPPQ |
| Ga0066669_103214052 | 3300018482 | Grasslands Soil | MKKKKKAATKSAARKTASRKPAAAKSAPTYTPKPVGGTGWAPFRYPPQ |
| Ga0137408_12073542 | 3300019789 | Vadose Zone Soil | MKKKKSAKTAARKPAAKKPAAQRQATTYTPKPVRGDGWAPFRYPPQ |
| Ga0210378_100227006 | 3300021073 | Groundwater Sediment | MKKKKATTKSAARKPVPKMPAGQRQAKTYTPKPLQGNGRAPFRYPPQ |
| Ga0207691_114509811 | 3300025940 | Miscanthus Rhizosphere | KAAARKRAGKKPAAPKQAKSGGTYTPKPVQGNGWAPFRYPPQ |
| Ga0209235_12183752 | 3300026296 | Grasslands Soil | MKKKKKTTAKSAARKTASRKPAAKTAATYTPKPVGGTGWAPFRYPPQ |
| Ga0209152_100036462 | 3300026325 | Soil | MKKKKSTTKAAARKRAGQKSAAPKQAKSAASYTPKPVQGNGWAPFRYPPQ |
| Ga0209801_13630021 | 3300026326 | Soil | MKKKKARTKSAARKTAKKPAAQRQAVTYTPKPMQGNGWAPFRYPPQ |
| Ga0257170_10141552 | 3300026351 | Soil | MKKKKATTKSAARKPAAKKPAGQRQTKTYTPKSLQGNGRAPFRYPPQ |
| Ga0257180_10494612 | 3300026354 | Soil | TTKAAARKRADKKPAAPKQAKSATTYTPKPLQGNGWAPFRYPPQ |
| Ga0257177_10161003 | 3300026480 | Soil | MKKKKATTKSAARKPAGERQAKTYTPKPLQGNGRAPFRYPP |
| Ga0209897_10511991 | 3300027169 | Groundwater Sand | MKKKKPTTKSAARKAAAKKPPAKRQGVAYTPKPLQGDGWAPFRYPPQ |
| Ga0209869_10358002 | 3300027187 | Groundwater Sand | KSAARKAAAKKPRAKRQGVAYTPKPLQGDGWAPFRYPPQ |
| Ga0209845_10188702 | 3300027324 | Groundwater Sand | MKRKKPRTKSAARKPTAKKPAAQKQAVTYTPKPLQGNGWAPFRY |
| Ga0209180_100054801 | 3300027846 | Vadose Zone Soil | MKKKKATTKSAARKPAAKKPAGQRQAKTYTPKPLQGNGRTPFRYPPQ |
| Ga0209283_107541312 | 3300027875 | Vadose Zone Soil | MKKKKATTKSAARKPAAKKPAGQRQATTYTPKSLQGNGRAPFRYPPQ |
| Ga0209853_10088131 | 3300027961 | Groundwater Sand | MKKKKPTTKSAARKAAAKKPPAKRQGVAYTPKPLQGDG |
| Ga0137415_103295762 | 3300028536 | Vadose Zone Soil | MKKKKKAAAKSAARKTVSRKPAAAKTAATYTPKPVGGTGWAPFRYPPQ |
| Ga0137415_111541811 | 3300028536 | Vadose Zone Soil | MKRKKARTKSAARKPTAKKPAAPKQAVTYTPKPLQGNGWAP |
| Ga0257175_11258382 | 3300028673 | Soil | RKRADKKPAAPKQAKSATTYTPKPLQGNGWAPFRYPPQ |
| Ga0307499_100357952 | 3300031184 | Soil | AGKKPATPKQAKSGGTYTPKPVQGNGWAPFRYPPQ |
| Ga0310888_100749802 | 3300031538 | Soil | MKKKRATPKAAARKRVSKKAAAPKQAKPAATYTPKPVQGNGWAPFRYPPQ |
| Ga0318560_107219401 | 3300031682 | Soil | TKAASRKRADKKPAAPKQAKSAGTYTPKPLQGNGWAPFRYPPQ |
| Ga0307469_100838762 | 3300031720 | Hardwood Forest Soil | MKKKKKVATKSAARKTGSRKPAAAKSAPTYTPKPVGGTGWAPFRYPPQ |
| Ga0307469_101629661 | 3300031720 | Hardwood Forest Soil | AGKKPAAPKQARSAGSYTPKPVEGNGWAPFRYPPQ |
| Ga0307468_1014742941 | 3300031740 | Hardwood Forest Soil | MKKKKSPKTAARKAAAKKPAARRPVSTYTPKPVQGDGWAPFRYPPQ |
| Ga0310901_103026151 | 3300031940 | Soil | VSKKAAAPKQAKPAATYTPKPVQGNGWAPFRYPPQ |
| Ga0318525_100286574 | 3300032089 | Soil | KAAARKPAGKKPAQPKPAKSAATYTPKPLQGNGWAPFRYPPQ |
| Ga0307471_1001886881 | 3300032180 | Hardwood Forest Soil | MKRKKKTTAKSAARKTASRKPAAAKTAATYTPKPVGGTGW |
| Ga0310896_102682401 | 3300032211 | Soil | MKKKRATPKAAARKRVSKKAAAPKQAKPAATYTPKPVQGNGWAPFRY |
| Ga0364924_047221_428_565 | 3300033811 | Sediment | MKKKKATTTARKPAAKKPAGQRQAKTYTPKPLQGNGRAPFRYPPQ |
| Ga0364926_085006_283_426 | 3300033812 | Sediment | MKKKKATTKSAARKPAPKKPAGQRQAKTYTPKPLQGNGRAPFRYPPQ |
| Ga0364938_048194_588_731 | 3300034114 | Sediment | MKKKKATTKSAVRKPADKTSAGQRQAKTYTPKPLQGNGRAPFRYPPQ |
| Ga0364943_0235905_226_366 | 3300034354 | Sediment | MKKKKSPKTPARKAASKKPAARRPASTYRPKPVQGDGWAPFRYPPQ |
| Ga0364941_007124_995_1135 | 3300034417 | Sediment | MKKKKSPKTPARKAASKKPAARRPASTYTPKPVQGDGWAPFRYPPQ |
| ⦗Top⦘ |