


| Basic Information | |
|---|---|
| Family ID | F100791 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKRMISSLMALALIALPLSAAEDKKETDRLENCGTVLKEIMDIPD |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.27 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.784 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (39.216 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.235 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02113 | Peptidase_S13 | 63.73 |
| PF00488 | MutS_V | 1.96 |
| PF13662 | Toprim_4 | 0.98 |
| PF13533 | Biotin_lipoyl_2 | 0.98 |
| PF00263 | Secretin | 0.98 |
| PF03641 | Lysine_decarbox | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 63.73 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 1.96 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 1.96 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.78 % |
| Unclassified | root | N/A | 39.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10582236 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300001867|JGI12627J18819_10440247 | Not Available | 533 | Open in IMG/M |
| 3300002914|JGI25617J43924_10326698 | Not Available | 530 | Open in IMG/M |
| 3300004082|Ga0062384_101053777 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005171|Ga0066677_10367881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 823 | Open in IMG/M |
| 3300005446|Ga0066686_10985377 | Not Available | 548 | Open in IMG/M |
| 3300005468|Ga0070707_101705144 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005526|Ga0073909_10518978 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005557|Ga0066704_10098727 | Not Available | 1914 | Open in IMG/M |
| 3300006050|Ga0075028_100835826 | Not Available | 563 | Open in IMG/M |
| 3300006050|Ga0075028_101030230 | Not Available | 513 | Open in IMG/M |
| 3300006050|Ga0075028_101072934 | Not Available | 504 | Open in IMG/M |
| 3300006052|Ga0075029_100382094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300006796|Ga0066665_10543190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300006806|Ga0079220_11816608 | Not Available | 537 | Open in IMG/M |
| 3300006914|Ga0075436_100555244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 843 | Open in IMG/M |
| 3300007258|Ga0099793_10165791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1051 | Open in IMG/M |
| 3300007265|Ga0099794_10202312 | Not Available | 1017 | Open in IMG/M |
| 3300009038|Ga0099829_10561877 | Not Available | 948 | Open in IMG/M |
| 3300009038|Ga0099829_10602578 | Not Available | 913 | Open in IMG/M |
| 3300009038|Ga0099829_11610896 | Not Available | 536 | Open in IMG/M |
| 3300009088|Ga0099830_10615450 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300009088|Ga0099830_10901950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300009088|Ga0099830_11812942 | Not Available | 510 | Open in IMG/M |
| 3300009089|Ga0099828_10868217 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300009090|Ga0099827_10127480 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300009137|Ga0066709_100089189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3722 | Open in IMG/M |
| 3300009143|Ga0099792_10602485 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300010320|Ga0134109_10290303 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010343|Ga0074044_10844448 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010376|Ga0126381_101720431 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300010398|Ga0126383_10605510 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300011271|Ga0137393_10186780 | Not Available | 1745 | Open in IMG/M |
| 3300011271|Ga0137393_10249180 | Not Available | 1507 | Open in IMG/M |
| 3300011271|Ga0137393_10926037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300012189|Ga0137388_10319255 | Not Available | 1427 | Open in IMG/M |
| 3300012189|Ga0137388_11938882 | Not Available | 518 | Open in IMG/M |
| 3300012205|Ga0137362_10108697 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
| 3300012205|Ga0137362_11525055 | Not Available | 555 | Open in IMG/M |
| 3300012210|Ga0137378_10728070 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300012351|Ga0137386_10023735 | All Organisms → cellular organisms → Bacteria | 4157 | Open in IMG/M |
| 3300012351|Ga0137386_10735049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012361|Ga0137360_11148425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300012363|Ga0137390_11024700 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012363|Ga0137390_11293964 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012683|Ga0137398_10795648 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012918|Ga0137396_10408732 | Not Available | 1006 | Open in IMG/M |
| 3300012923|Ga0137359_11092232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300012931|Ga0153915_11035406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300012960|Ga0164301_10622108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300012971|Ga0126369_12961604 | Not Available | 556 | Open in IMG/M |
| 3300015054|Ga0137420_1193840 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300016445|Ga0182038_11838316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 547 | Open in IMG/M |
| 3300017823|Ga0187818_10370268 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300017955|Ga0187817_10312610 | Not Available | 1002 | Open in IMG/M |
| 3300017955|Ga0187817_10766238 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300017974|Ga0187777_10535028 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300018468|Ga0066662_12058876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300019866|Ga0193756_1008979 | Not Available | 1291 | Open in IMG/M |
| 3300020580|Ga0210403_10121223 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300021086|Ga0179596_10209049 | Not Available | 952 | Open in IMG/M |
| 3300021088|Ga0210404_10008858 | All Organisms → cellular organisms → Bacteria | 4079 | Open in IMG/M |
| 3300021088|Ga0210404_10332711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300021178|Ga0210408_10873613 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300021404|Ga0210389_10813818 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300021433|Ga0210391_10349914 | Not Available | 1159 | Open in IMG/M |
| 3300021433|Ga0210391_10841253 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300021477|Ga0210398_11520673 | Not Available | 520 | Open in IMG/M |
| 3300021478|Ga0210402_11629032 | Not Available | 572 | Open in IMG/M |
| 3300021560|Ga0126371_11932487 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300024271|Ga0224564_1050903 | Not Available | 807 | Open in IMG/M |
| 3300024330|Ga0137417_1121774 | Not Available | 1123 | Open in IMG/M |
| 3300024330|Ga0137417_1121775 | Not Available | 1053 | Open in IMG/M |
| 3300025934|Ga0207686_10339738 | Not Available | 1127 | Open in IMG/M |
| 3300026281|Ga0209863_10076877 | Not Available | 984 | Open in IMG/M |
| 3300026315|Ga0209686_1129382 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300026328|Ga0209802_1019447 | All Organisms → cellular organisms → Bacteria | 3770 | Open in IMG/M |
| 3300026334|Ga0209377_1324675 | Not Available | 515 | Open in IMG/M |
| 3300026371|Ga0257179_1017866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300026469|Ga0257169_1020172 | Not Available | 940 | Open in IMG/M |
| 3300026552|Ga0209577_10719555 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026555|Ga0179593_1193815 | All Organisms → cellular organisms → Bacteria | 3667 | Open in IMG/M |
| 3300026557|Ga0179587_10468100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300026999|Ga0207949_1016038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300027070|Ga0208365_1030729 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300027603|Ga0209331_1050619 | Not Available | 1051 | Open in IMG/M |
| 3300027643|Ga0209076_1007970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2636 | Open in IMG/M |
| 3300027645|Ga0209117_1121222 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300027862|Ga0209701_10614125 | Not Available | 574 | Open in IMG/M |
| 3300027875|Ga0209283_10506509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300027882|Ga0209590_10065377 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300027882|Ga0209590_10411268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300027898|Ga0209067_10677457 | Not Available | 596 | Open in IMG/M |
| 3300028536|Ga0137415_10540394 | Not Available | 975 | Open in IMG/M |
| 3300028536|Ga0137415_10715837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300031715|Ga0307476_10509773 | Not Available | 891 | Open in IMG/M |
| 3300031720|Ga0307469_10297485 | Not Available | 1327 | Open in IMG/M |
| 3300031754|Ga0307475_10684540 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031777|Ga0318543_10137299 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300031962|Ga0307479_10188817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2028 | Open in IMG/M |
| 3300031962|Ga0307479_10641931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 39.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.98% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105822362 | 3300001593 | Forest Soil | MLKRMLSPLLVLAMIGLPLPAQDKKETERLDNCGTVLKEILDIP |
| JGI12627J18819_104402472 | 3300001867 | Forest Soil | MLKRLTSSVLVLAIAALPISRAGDTKETGRLENCGTVLKEI |
| JGI25617J43924_103266982 | 3300002914 | Grasslands Soil | MISSLMALALAALPLLAARDNRKETDRLENCGAVIKEVMDI |
| Ga0062384_1010537771 | 3300004082 | Bog Forest Soil | MRKQMVSSLLGLAMLAAPMAAQDKKEADRLQNCGTVLKEILDIPDD |
| Ga0066677_103678812 | 3300005171 | Soil | MLTFLVVFSLVALPLTAKDSKKEADRMENCGTVLKEILDIPDD |
| Ga0066686_109853771 | 3300005446 | Soil | VIKRMISSLMALALVALPLFGAGDKKETERLENCGSVVKEVMDI |
| Ga0070707_1017051442 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQRIMSSLLALAIAFPLAAEDKKKETDRLENCGLVLKEIL |
| Ga0073909_105189782 | 3300005526 | Surface Soil | MLQRIMSSLLALAIALPLAAADNKKETDRLENCGLVL |
| Ga0066704_100987272 | 3300005557 | Soil | VIQRMISTLVALALAALPLSAAEDQKEADRLDNCGTVLKEI |
| Ga0075028_1008358261 | 3300006050 | Watersheds | VIKQMLACLMGLILAALPLSAANDKKETDRLDNCGMVI |
| Ga0075028_1010302301 | 3300006050 | Watersheds | VIKRMISTLMTMALVALPLSAAGDRKETDRLENCGMI |
| Ga0075028_1010729342 | 3300006050 | Watersheds | MKRMMSCLMALAMVALPLFAAKDKKETDRLENCGMVIKEVM |
| Ga0075029_1003820942 | 3300006052 | Watersheds | VIKRMISTLMALTLVALPLLAAGDKKETDRLENCGMVVKEVMDIP |
| Ga0066665_105431901 | 3300006796 | Soil | VIKRMLSSLVALALIALPLSAAKDIKETERRENCGTVLK |
| Ga0079220_118166081 | 3300006806 | Agricultural Soil | MLKQLMSSVLALAIALPLAAADSKKETDRLENCGLI |
| Ga0075436_1005552441 | 3300006914 | Populus Rhizosphere | MKKFAALLAAAVILAGPLAAASKDDKETDRLENCGMILKEIMDIPDDI |
| Ga0099793_101657911 | 3300007258 | Vadose Zone Soil | MISYLMALALIAPPLLAARDKKETERLENCGMIVKEVM |
| Ga0099794_102023121 | 3300007265 | Vadose Zone Soil | VIKRLISFLMTWALVALPLSAKEDKKETDRLDNCGTVLKEILD |
| Ga0099829_105618772 | 3300009038 | Vadose Zone Soil | MKRTLSLFLAMALLALPLSAGDKNKKELDRLENCGTVLKEILDI |
| Ga0099829_106025781 | 3300009038 | Vadose Zone Soil | MSSVLALAIALPLAAADNKKETERLENCGLVLKEILDIPDDIP |
| Ga0099829_116108962 | 3300009038 | Vadose Zone Soil | MSLLAAFALIALPAGADNKKETERLDNCGTVLKEILDIPDDIPSDL |
| Ga0099830_106154501 | 3300009088 | Vadose Zone Soil | MFSSLVALALIALPLSAAKDIKETERLENCGTVLKEIM |
| Ga0099830_109019501 | 3300009088 | Vadose Zone Soil | MKRMISSLMALALIALPLSAAEDKKETDRLENCGTVLKEIMDIPD |
| Ga0099830_118129422 | 3300009088 | Vadose Zone Soil | MSLLAAFALIALPAGADNKKETERLDNCGTVLKEILDIPDDIP |
| Ga0099828_108682171 | 3300009089 | Vadose Zone Soil | MLKRMTSSLLTLALVALPLAAADNQKEVDRLENCGMVLKEILDIPDD |
| Ga0099827_101274803 | 3300009090 | Vadose Zone Soil | MISSLMALALVALPLLAAGDKKETERLENCGMILK |
| Ga0066709_1000891892 | 3300009137 | Grasslands Soil | MKRMGSFLCAFLLITLPLAAGDNKKEQDRLENCG* |
| Ga0099792_106024852 | 3300009143 | Vadose Zone Soil | MLKRMTSSLVALALIALPLSAADNQKEVDRLENCGMVLKEILD |
| Ga0134109_102903031 | 3300010320 | Grasslands Soil | MLTFLMVFSLVALPLTAKDSKKEADRLENCGTVLKEIL |
| Ga0074044_108444482 | 3300010343 | Bog Forest Soil | MLKRILSPLLALAVIGLPLSAQVDKKEADRLDNCGTVMKE |
| Ga0126381_1017204312 | 3300010376 | Tropical Forest Soil | MLTFLMAFSLVALPLTAKDSKKEADRLENCGTVLKEILD |
| Ga0126383_106055101 | 3300010398 | Tropical Forest Soil | MACSLVALPLIAGKKETDRLDNCGTVLKEIIDIPEDIPSD |
| Ga0137393_101867802 | 3300011271 | Vadose Zone Soil | VLKRLISLLVTWALVVLPLSAREDKKETERLDNCGTVL |
| Ga0137393_102491801 | 3300011271 | Vadose Zone Soil | MISSLMSLAMVALPLSAAEEQKEADRLDNCGTVLKEILDIPD |
| Ga0137393_109260372 | 3300011271 | Vadose Zone Soil | MISWVMAFAMVALPLSAAEDQKEADRLDNCGTVLKEILDIPD |
| Ga0137388_103192552 | 3300012189 | Vadose Zone Soil | MLKRMTSSLLTLALVALPLAAADNQKEVDRLENCGMVLKEILDI |
| Ga0137388_119388821 | 3300012189 | Vadose Zone Soil | MISSLMALALAALPLLAARDNRKETDRLENCGMIV |
| Ga0137362_101086971 | 3300012205 | Vadose Zone Soil | VIKRMISSLTALALVASPLLGAGDRKETDRLENCGMVIK |
| Ga0137362_115250551 | 3300012205 | Vadose Zone Soil | MWKQLMSSVLALAIALPLAAADSKKETDRLENCGLI |
| Ga0137378_107280701 | 3300012210 | Vadose Zone Soil | MISFLMAFSLVALPLSADSKKEAERLDNCGTVLKEILDI |
| Ga0137386_100237354 | 3300012351 | Vadose Zone Soil | VLKRLISLLVTWALVALPLSAREDKKETDRLDNCG |
| Ga0137386_107350491 | 3300012351 | Vadose Zone Soil | MISTLVALALAAFPLSAAEDQKEADRLDNCGTALKEILDIPDN |
| Ga0137360_111484251 | 3300012361 | Vadose Zone Soil | VLKRLTSLLMTWALVALPLSAKEDKKETDRLDNCGTVLK |
| Ga0137390_110247001 | 3300012363 | Vadose Zone Soil | MLSPLLAMAMIGLPLSAAQEKKEADRLDNRGTVLKEILD |
| Ga0137390_112939641 | 3300012363 | Vadose Zone Soil | MSSVLALAIALPLAAADNKKETERLENCGLVLKEILDIPDDI |
| Ga0137398_107956482 | 3300012683 | Vadose Zone Soil | MSSLLALAIALPLAAADKKKEIDRLENCGQVLKEILDIPDDIP |
| Ga0137396_104087322 | 3300012918 | Vadose Zone Soil | MLKRILSFLLALALIALPLSAADNKKEVDRLENCGMVLKEI |
| Ga0137359_110922322 | 3300012923 | Vadose Zone Soil | MISSLTALALVASPLLGAGDRKETDRLENCGMVIKEVMDI |
| Ga0153915_110354062 | 3300012931 | Freshwater Wetlands | VSKRILSLLTILALTVLPLSAEDKKETERLDNCGTVLKE |
| Ga0164301_106221082 | 3300012960 | Soil | MLKRMLSLFVGLAMIGLPLSASDKKEADRLQNCGTVLKEILDIPDDI |
| Ga0126369_129616042 | 3300012971 | Tropical Forest Soil | MLSPALALVILFLPLASAEDKKEADRLDNCGTVLKEILDIP |
| Ga0137420_11938401 | 3300015054 | Vadose Zone Soil | MSSVLALAIALPLAAADKKKETDRLENCGQVLKEILDIPDDYSA |
| Ga0182038_118383161 | 3300016445 | Soil | MKRMISLLMASSLVALPLTANDNKKETHRLENCGTVVKEILDIP |
| Ga0187818_103702682 | 3300017823 | Freshwater Sediment | MKRSLSLLLAFSMTCLPLFADNKKETDRLDNCGMVLKEILDIP |
| Ga0187817_103126101 | 3300017955 | Freshwater Sediment | LIKRIGSSLVALALMVLPLSAARDTKQTDRLENCGTV |
| Ga0187817_107662382 | 3300017955 | Freshwater Sediment | MISALMGLALIGLPLLAADETKETDRLENCGTVIREIM |
| Ga0187777_105350281 | 3300017974 | Tropical Peatland | MAISLAALPIMAAGDKKEADRLENCGTVIKEIMDIP |
| Ga0066662_120588761 | 3300018468 | Grasslands Soil | VIKQMLSCLMALALVALPLSAAKDKKETERLENCGTVIKEVMDIPDDIPPDL |
| Ga0193756_10089792 | 3300019866 | Soil | VIKRMISSLVALALVALPLLASGDKKETARLENCGLIVKEVMDIPDN |
| Ga0210403_101212233 | 3300020580 | Soil | MALVLLAPGLLAAGDRKETERLENCGMVIKEVMDIPDNIPED |
| Ga0179596_102090491 | 3300021086 | Vadose Zone Soil | MTKRIVVYLTALVLVSLPLAGAQDTKEADRLENCGTVLKEI |
| Ga0210404_100088581 | 3300021088 | Soil | MLKPMMSSVLALAIALPLVAADSKKETDRLENCGLILKEILDIPDDIP |
| Ga0210404_103327112 | 3300021088 | Soil | VIKRMISSLMALALIALPLLAAGDKKETERLENCGLIIKEVMDIP |
| Ga0210408_108736131 | 3300021178 | Soil | MIKRLLSVLLAFSMASLPLCAADDKKEADRLDNCGTVLKEILDIPD |
| Ga0210389_108138181 | 3300021404 | Soil | MRRMMVYLLALAMVGLPLFAAQDKKEADRLDNCGT |
| Ga0210391_103499142 | 3300021433 | Soil | MKRMMVYLLALVMVSLPLFAGQDKKEADRLDNCGTVLQEILDIP |
| Ga0210391_108412532 | 3300021433 | Soil | MMRRMMVYLLALAMVGLPLFAAQDKKEADRLDNCG |
| Ga0210398_115206731 | 3300021477 | Soil | MKRIFSLMVALSMAGLPLSAGGDKKETDRLDNCGTVLREILDIPDDIP |
| Ga0210402_116290322 | 3300021478 | Soil | VIKRMISSLVTMALVALPLSAAGDRKETDRLENCGMVIKEVM |
| Ga0126371_119324872 | 3300021560 | Tropical Forest Soil | MLSLLMAFSLVALPLTAKDNKKEADRLENCGTVLKEI |
| Ga0224564_10509031 | 3300024271 | Soil | LIERIIASLMTLGLIALPLSAAEEKKETDRLENCGTVMKEIMDIPD |
| Ga0137417_11217741 | 3300024330 | Vadose Zone Soil | MLKQLMSSVLALAIALPLAAADSKKETDRLENCGLVLK |
| Ga0137417_11217752 | 3300024330 | Vadose Zone Soil | MLKQLMSSVLALAIALPLAAADSKKETDRLENCGLVLKEILDI |
| Ga0207686_103397381 | 3300025934 | Miscanthus Rhizosphere | MLKRMLSLLVALAMIGLPLSASDKKETDRLQNCGTVLKEILDIPDNI |
| Ga0209863_100768772 | 3300026281 | Prmafrost Soil | MTKRIFVYLTALVMASLPLAAAQDTKEADRLDNCGTVVKEILDIPDD |
| Ga0209686_11293821 | 3300026315 | Soil | MLTFLVVFSLVALPLTAKDSKKEADRMENCGTVLKEILDI |
| Ga0209802_10194474 | 3300026328 | Soil | VIQRMISTLVALALVALPLSAADEQKEADRLDNCGTVLKEIL |
| Ga0209377_13246752 | 3300026334 | Soil | VLKRLISFLMTWALVVLPLSAKEDNKKETDRLDNCGTVLKEI |
| Ga0257179_10178662 | 3300026371 | Soil | VIKRMISYLMALALIALPLLAAGAKKETERLENCGMI |
| Ga0257169_10201722 | 3300026469 | Soil | VIKQMMSCLMALALVALPLSAAKDKKETDRLDNCGTVIKE |
| Ga0209577_107195551 | 3300026552 | Soil | VLKRMLCLLMAFSLVALPLTAKESKEAERLDNCGTVLKEI |
| Ga0179593_119381511 | 3300026555 | Vadose Zone Soil | VIKRTISSLMALALVALPLLAAGDKKETERLENCGEVIK |
| Ga0179587_104681001 | 3300026557 | Vadose Zone Soil | VIKRMISTQMALLLVALPLLASGDKKEVDRLENCGMVIKEV |
| Ga0207949_10160381 | 3300026999 | Forest Soil | VFKRMISSLMALAMAALPLCAAGDQKEADRLDNCGTVLKE |
| Ga0208365_10307292 | 3300027070 | Forest Soil | MKRMMVYLLALAMVGLPLHAAQDKKEADRLDNCGTVLKEILDIPDD |
| Ga0209331_10506192 | 3300027603 | Forest Soil | MLKRVTSSLLALGLIALPLLAADNRKEVDRLENCGMVLKEILDIPDD |
| Ga0209076_10079704 | 3300027643 | Vadose Zone Soil | VIKRISSSLMALALVALPLLAAGDKKETDRLENCGM |
| Ga0209117_11212222 | 3300027645 | Forest Soil | MLKRMTCSLLALALVTLPLSAADNKKEVDRLENCGMVLKEILDIPDDI |
| Ga0209701_106141251 | 3300027862 | Vadose Zone Soil | MKRMISSLMALALIALPLSAAEDKKETDRLENCGTVLK |
| Ga0209283_105065093 | 3300027875 | Vadose Zone Soil | VLKRLISFLVTWALVALPLSAKEDKKETDRLDNCGT |
| Ga0209590_100653771 | 3300027882 | Vadose Zone Soil | VIKRMISSLMALALVALPLLASGDKKETGRLENCGLIVKEVMDIP |
| Ga0209590_104112681 | 3300027882 | Vadose Zone Soil | VIKRMFSSLLALALIALPLSAAKDIKETERLENCGSVLKEIMDIPDNI |
| Ga0209067_106774572 | 3300027898 | Watersheds | MKRSFSLLLAFSMTCLPLVADDKKEADRLDNCGTVMK |
| Ga0137415_105403943 | 3300028536 | Vadose Zone Soil | MTKRSLSLLLAFSMTSLPLSADNKKEADRLDNSGTVLKEIL |
| Ga0137415_107158372 | 3300028536 | Vadose Zone Soil | VIKRMISSLMALALVALPLLAAGDKKETERLENCGEVIKEV |
| Ga0308309_100065211 | 3300028906 | Soil | LIKKISSCLMALAMIAPPLLSQADKKEADRLENCGTVMKEIMDIPD |
| Ga0307476_105097731 | 3300031715 | Hardwood Forest Soil | MLQRIMSTLLAITLALPLAVADSKKETDRLENCGLVLK |
| Ga0307469_102974852 | 3300031720 | Hardwood Forest Soil | MLKRMLSLFVGLAMIGLPLSASDKKEADRLQNCGTVLKEILDIP |
| Ga0307475_106845401 | 3300031754 | Hardwood Forest Soil | MRRMMVYLLALAMVGLPLFAAQDKKEADRLDNCGTVLKEILDI |
| Ga0318543_101372991 | 3300031777 | Soil | VLKRILAVLMACSLVALPLIAGKKETDRLDNCGTVLKEIIDIP |
| Ga0307479_101888172 | 3300031962 | Hardwood Forest Soil | MSYLVALVLIALPLSAADNKRETGRLENCGTVIKEIMDIPDDIPKDL |
| Ga0307479_106419312 | 3300031962 | Hardwood Forest Soil | LIKRMMSYLVALVLIALPLSAADNKRETGRLENCGTVIKEIMDIPDDIPKDL |
| ⦗Top⦘ |