


| Basic Information | |
|---|---|
| Family ID | F100778 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.69 % |
| % of genes near scaffold ends (potentially truncated) | 81.37 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.176 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.745 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.235 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.30% β-sheet: 10.64% Coil/Unstructured: 51.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 22.55 |
| PF04879 | Molybdop_Fe4S4 | 7.84 |
| PF04909 | Amidohydro_2 | 3.92 |
| PF03795 | YCII | 2.94 |
| PF02784 | Orn_Arg_deC_N | 2.94 |
| PF02738 | MoCoBD_1 | 2.94 |
| PF02567 | PhzC-PhzF | 1.96 |
| PF01958 | Asp_DH_C | 1.96 |
| PF00296 | Bac_luciferase | 1.96 |
| PF02728 | Cu_amine_oxidN3 | 1.96 |
| PF01925 | TauE | 0.98 |
| PF06441 | EHN | 0.98 |
| PF00149 | Metallophos | 0.98 |
| PF05598 | DUF772 | 0.98 |
| PF13011 | LZ_Tnp_IS481 | 0.98 |
| PF01243 | Putative_PNPOx | 0.98 |
| PF02900 | LigB | 0.98 |
| PF02371 | Transposase_20 | 0.98 |
| PF02668 | TauD | 0.98 |
| PF00067 | p450 | 0.98 |
| PF07969 | Amidohydro_3 | 0.98 |
| PF13460 | NAD_binding_10 | 0.98 |
| PF12840 | HTH_20 | 0.98 |
| PF00753 | Lactamase_B | 0.98 |
| PF08386 | Abhydrolase_4 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF16694 | Cytochrome_P460 | 0.98 |
| PF12867 | DinB_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 2.94 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 2.94 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.94 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.96 |
| COG1712 | L-aspartate dehydrogenase, NAD(P)-dependent | Amino acid transport and metabolism [E] | 1.96 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.96 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.96 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.98 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.98 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.98 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.98 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.18 % |
| Unclassified | root | N/A | 8.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0347833 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300001199|J055_10087274 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300004267|Ga0066396_10047080 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 682 | Open in IMG/M |
| 3300004267|Ga0066396_10087368 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300004633|Ga0066395_11035467 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005172|Ga0066683_10531652 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005180|Ga0066685_10395848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 959 | Open in IMG/M |
| 3300005332|Ga0066388_100428904 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1965 | Open in IMG/M |
| 3300005332|Ga0066388_103831970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas azotifigens | 767 | Open in IMG/M |
| 3300005338|Ga0068868_100836193 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300005406|Ga0070703_10302101 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005440|Ga0070705_100512491 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005447|Ga0066689_10898926 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005467|Ga0070706_101699866 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005468|Ga0070707_100688558 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005471|Ga0070698_100983553 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005518|Ga0070699_101765106 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005526|Ga0073909_10432431 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005549|Ga0070704_101624578 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005558|Ga0066698_10257178 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005559|Ga0066700_10193791 | Not Available | 1401 | Open in IMG/M |
| 3300005617|Ga0068859_102692791 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005764|Ga0066903_107797218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
| 3300006796|Ga0066665_11302433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300006844|Ga0075428_101205392 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006847|Ga0075431_100285618 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1670 | Open in IMG/M |
| 3300006852|Ga0075433_10239238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1612 | Open in IMG/M |
| 3300006904|Ga0075424_100944829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 920 | Open in IMG/M |
| 3300006914|Ga0075436_100795110 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 704 | Open in IMG/M |
| 3300009100|Ga0075418_11801551 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300009101|Ga0105247_11134270 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300009147|Ga0114129_12968897 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009156|Ga0111538_12805995 | Not Available | 610 | Open in IMG/M |
| 3300009162|Ga0075423_13196541 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009166|Ga0105100_10969032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300009177|Ga0105248_11633085 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 730 | Open in IMG/M |
| 3300009795|Ga0105059_1010690 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300009817|Ga0105062_1112639 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010043|Ga0126380_10700270 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300010046|Ga0126384_11157611 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010358|Ga0126370_11686437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
| 3300010360|Ga0126372_10828350 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300010361|Ga0126378_12323956 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010361|Ga0126378_13267306 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010362|Ga0126377_11350879 | Not Available | 785 | Open in IMG/M |
| 3300010362|Ga0126377_13036874 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010362|Ga0126377_13308946 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010366|Ga0126379_11379909 | Not Available | 811 | Open in IMG/M |
| 3300010376|Ga0126381_104537448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300010398|Ga0126383_10163015 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300010863|Ga0124850_1012688 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
| 3300012199|Ga0137383_11263960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300012209|Ga0137379_10070009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3373 | Open in IMG/M |
| 3300012350|Ga0137372_10063023 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
| 3300012357|Ga0137384_10011881 | All Organisms → cellular organisms → Bacteria | 7072 | Open in IMG/M |
| 3300012358|Ga0137368_10518081 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300012360|Ga0137375_10150638 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300012510|Ga0157316_1060664 | Not Available | 547 | Open in IMG/M |
| 3300012685|Ga0137397_10492221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 913 | Open in IMG/M |
| 3300012901|Ga0157288_10301671 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012904|Ga0157282_10030046 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300012912|Ga0157306_10166141 | Not Available | 712 | Open in IMG/M |
| 3300012971|Ga0126369_12794439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300015245|Ga0137409_11131078 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300015264|Ga0137403_11379245 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300015371|Ga0132258_11074645 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300015373|Ga0132257_101851752 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300016319|Ga0182033_10311567 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300016445|Ga0182038_10753664 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300018078|Ga0184612_10200388 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Thalassoglobus → Thalassoglobus neptunius | 1037 | Open in IMG/M |
| 3300018422|Ga0190265_12486260 | Not Available | 617 | Open in IMG/M |
| 3300020068|Ga0184649_1174965 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300020170|Ga0179594_10229515 | Not Available | 698 | Open in IMG/M |
| 3300022534|Ga0224452_1088495 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300025899|Ga0207642_10472221 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300025910|Ga0207684_10985285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 706 | Open in IMG/M |
| 3300025918|Ga0207662_10344922 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300025930|Ga0207701_11074973 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300026360|Ga0257173_1036452 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027006|Ga0209896_1039626 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300027187|Ga0209869_1007095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1204 | Open in IMG/M |
| 3300027874|Ga0209465_10231975 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300027874|Ga0209465_10538279 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027907|Ga0207428_10693530 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300028587|Ga0247828_10821195 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031680|Ga0318574_10281306 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 965 | Open in IMG/M |
| 3300031740|Ga0307468_100897865 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031744|Ga0306918_10287810 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1263 | Open in IMG/M |
| 3300031764|Ga0318535_10084376 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300031778|Ga0318498_10332914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300031781|Ga0318547_10948513 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
| 3300031820|Ga0307473_11024276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
| 3300031908|Ga0310900_10408685 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300032017|Ga0310899_10682677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → unclassified Paenibacillaceae → Paenibacillaceae bacterium | 520 | Open in IMG/M |
| 3300032039|Ga0318559_10303432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300032090|Ga0318518_10126006 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300032090|Ga0318518_10395811 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 709 | Open in IMG/M |
| 3300032180|Ga0307471_103634654 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300033289|Ga0310914_10483108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1121 | Open in IMG/M |
| 3300033433|Ga0326726_12368220 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300033551|Ga0247830_10959353 | Not Available | 682 | Open in IMG/M |
| 3300033805|Ga0314864_0219928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001199 | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027187 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_03478333 | 3300000033 | Soil | RAGVFELXARPRVVRAEDIHTVAASLLAMLRRENAGIVVG* |
| J055_100872743 | 3300001199 | Lotic | SAGRTMGFTVRSRAGVFELMSRPRVVRAEDIHTVAASLIAMLRRETAGIVVG* |
| Ga0066396_100470801 | 3300004267 | Tropical Forest Soil | PRGSTGRTMGFTARSRAGVFEVMARPRVVRAEDIHTVAASLIAMLRRENAGIVVG* |
| Ga0066396_100873681 | 3300004267 | Tropical Forest Soil | RSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0066395_110354671 | 3300004633 | Tropical Forest Soil | STGRTMGFTARSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRENAGIVVG* |
| Ga0066683_105316521 | 3300005172 | Soil | TMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0066685_103958482 | 3300005180 | Soil | SRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0066388_1004289041 | 3300005332 | Tropical Forest Soil | GRTMGFTVRSRVGVFELMARPRVVRAEDIHMVAASLIAMLSRETAGIVIG* |
| Ga0066388_1038319701 | 3300005332 | Tropical Forest Soil | GRTMGFTVRSRVGVFELMARPRVVRAEDIHMVAASLIAMLRRETAGIVIG* |
| Ga0068868_1008361931 | 3300005338 | Miscanthus Rhizosphere | FTVRSRAGVFELTAKPRVVPAEDIHTVASSLIAMLRREMAGIVVG* |
| Ga0070703_103021011 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | FTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0070705_1005124912 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVFELMARPRVVRAEDIHMVAASLIAMLRRETAGIVIG* |
| Ga0066689_108989261 | 3300005447 | Soil | RGSGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0070706_1016998662 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AGVFELTAKPRVVPAEDIHTVAASLIAMLRREMAGIVVG* |
| Ga0070707_1006885583 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GTVGRTMGFTVRSRAGVFELTAKPRVVPAEDIHTVAASLIAMLRREMAGIVVG* |
| Ga0070698_1009835532 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RTMGFTVRSRAGVFELTAKPRVVPAEDIHTVASSLIAMLRREVAGVVVG* |
| Ga0070699_1017651061 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0073909_104324311 | 3300005526 | Surface Soil | ELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0070704_1016245781 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PRGSVGRTMGFTVRSRVGVFELMARPRVVRAEDIHMVAASLIAMLRRETAGIVIG* |
| Ga0066698_102571783 | 3300005558 | Soil | SAGRTMGFTVRSRAGVFELMARPRVVRADDIHTVAASLIAMLRRETAGIVIG* |
| Ga0066700_101937912 | 3300005559 | Soil | FTVRSRVGVFELMAKPRVVRAEDIHTVAASLLAMLRRETTGIVIG* |
| Ga0068859_1026927911 | 3300005617 | Switchgrass Rhizosphere | GTVGRTMGFTVRSRAGVFELTAKPRVVPAEDIHTVASSLIAMLRRETAGIVVG* |
| Ga0066903_1077972181 | 3300005764 | Tropical Forest Soil | TMGFTVRSRAGVFELTARPRVVPAEDIHTVAASVIAMLRREVSGIVIG* |
| Ga0066665_113024332 | 3300006796 | Soil | ELMAKPRVVRAEDIHTVAASLLAMLRRETTGIVIG* |
| Ga0075428_1012053922 | 3300006844 | Populus Rhizosphere | RTPRGSAGRTMGFAVRSRVGVFELMARPRVVRAEDIHTVAASLIAMLRREMAGIVIG* |
| Ga0075431_1002856181 | 3300006847 | Populus Rhizosphere | SAGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0075433_102392381 | 3300006852 | Populus Rhizosphere | GVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0075424_1009448292 | 3300006904 | Populus Rhizosphere | MGFTLRSRAGVFELMARPRVVRAEDIRTVAASVIAMLCRETAGIVVG* |
| Ga0075436_1007951101 | 3300006914 | Populus Rhizosphere | FTVRSRAGVFELMSRPRVVRAEDVHTVAASLIAMLRRETKGIVIG* |
| Ga0075418_118015511 | 3300009100 | Populus Rhizosphere | AKGAIGRTMGFTVRSRAGVFELTARPRVVPAEDIHTVAASLIAMLRRESAGILVG* |
| Ga0105247_111342701 | 3300009101 | Switchgrass Rhizosphere | VRSRAGVFELTAKPRVVPAEDIHTVASSLIAMLRREVAGIVVG* |
| Ga0114129_129688972 | 3300009147 | Populus Rhizosphere | AGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0111538_128059952 | 3300009156 | Populus Rhizosphere | MGFTVRSRVGVFELMAKPRVVRAEDIHTVAASVLAMLRRETTGIVIG* |
| Ga0075423_131965411 | 3300009162 | Populus Rhizosphere | RGSAGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0105100_109690323 | 3300009166 | Freshwater Sediment | RSRAGVFELRSRPRVVRAEDIHTVAASLIAILRRETAGIIVG* |
| Ga0105248_116330851 | 3300009177 | Switchgrass Rhizosphere | TVGRTMGFTVRSRAGVFELTAKPRVVPAEDIHTVASSLIAMLRRETAGIVVG* |
| Ga0105059_10106903 | 3300009795 | Groundwater Sand | LMARPRVVRAEDIHTVAASLIAMLRRETAGILIG* |
| Ga0105062_11126392 | 3300009817 | Groundwater Sand | MGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0126380_107002701 | 3300010043 | Tropical Forest Soil | RSRAGVFEVMARPRVVRAEDIHTVAASLIAMLRRENAGIVIG* |
| Ga0126384_111576111 | 3300010046 | Tropical Forest Soil | RVGVFELTARPRVVRAEDIHMVAASLIAMLRRETAGIVIG* |
| Ga0126370_116864371 | 3300010358 | Tropical Forest Soil | GRTMGFTVRSRAGVFELTARPRVVPAEDIHTVAASLIAMLRRETTGIIVG* |
| Ga0126372_108283503 | 3300010360 | Tropical Forest Soil | RTMGFTARSRAGIFELTARPRVVPAEDIHAVAASLIAMLRRETAGIVVG* |
| Ga0126378_123239561 | 3300010361 | Tropical Forest Soil | LMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0126378_132673062 | 3300010361 | Tropical Forest Soil | ELMARPRVVRAEDIHTVAASLIAMLRRENAGIVVG* |
| Ga0126377_113508792 | 3300010362 | Tropical Forest Soil | MGFTVRSRAGGFELTARPRVVPAEDIHTVAVSLIALLR |
| Ga0126377_130368742 | 3300010362 | Tropical Forest Soil | GRTMGFTVRSPAGAFEVTARPRVVREDDVHAVAASLIAMLRGTTGGIAVAAS* |
| Ga0126377_133089461 | 3300010362 | Tropical Forest Soil | ELMARPRVVRTEDIHMVAASLIAMLRRETAGIVVG* |
| Ga0126379_113799091 | 3300010366 | Tropical Forest Soil | VMRPPKGSVGRTMGFTARSRVGVFELMARPRVVRAEDIHMVAASLIAMLRRETAGIVIG* |
| Ga0126381_1045374482 | 3300010376 | Tropical Forest Soil | MGFTARSQAGVFELMARPRVVRAEDIHTVAASLIAMLRRENAGIVVG* |
| Ga0126383_101630152 | 3300010398 | Tropical Forest Soil | GRTMGFTVRSRAGVFELTARPRVVPAEDIHTVAASLIAMLRRETTGIVIG* |
| Ga0124850_10126884 | 3300010863 | Tropical Forest Soil | MGFTARSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRENAGIVIG* |
| Ga0137383_112639602 | 3300012199 | Vadose Zone Soil | MVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0137379_100700093 | 3300012209 | Vadose Zone Soil | VRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0137372_100630235 | 3300012350 | Vadose Zone Soil | MVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIAIG* |
| Ga0137384_1001188111 | 3300012357 | Vadose Zone Soil | MVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAAIIIG* |
| Ga0137368_105180812 | 3300012358 | Vadose Zone Soil | MGFTVRSRAGVFDLMASPRVVRTEDIHTVAASLIAMLRRETVRIVIG* |
| Ga0137375_101506383 | 3300012360 | Vadose Zone Soil | MGFTVRSRAGVFDLMARPRVVRAEDIHTVAASLIAMLRRETVRIVIG* |
| Ga0157316_10606641 | 3300012510 | Arabidopsis Rhizosphere | AGVFELMARPRVVRDQDIHTVAASLIAMLRRETAGIVIG* |
| Ga0137397_104922212 | 3300012685 | Vadose Zone Soil | AGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0157288_103016712 | 3300012901 | Soil | MGFTVRSRAGVFELTAKPRVVPAEDIHTVAASLIAMLRRETAGIVVG* |
| Ga0157282_100300462 | 3300012904 | Soil | GVFELTAKPRVVPAEDIHTVAASLIAMLRRETAGIVVG* |
| Ga0157306_101661411 | 3300012912 | Soil | AGRTMGFTVRSRVGVFELMAKPRVVRAEDIHTVAASVLPMLRRETTGIVIG* |
| Ga0126369_127944391 | 3300012971 | Tropical Forest Soil | MGFAVRSPAGLVEVTSRPRVAPAEDAHPVAASLIAMLRGTAAGIAVGPG* |
| Ga0137409_111310781 | 3300015245 | Vadose Zone Soil | MGFTVHSRVGVFELMAKPRVVRAEDIHTVAASLLAMLRRETTGIVIG* |
| Ga0137403_113792452 | 3300015264 | Vadose Zone Soil | GSAGRRMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0132258_110746455 | 3300015371 | Arabidopsis Rhizosphere | MGFTVRSRAGVFELMARPRVVRADDIHTVAASLIAMLRRETAGIVIG* |
| Ga0132257_1018517521 | 3300015373 | Arabidopsis Rhizosphere | VFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG* |
| Ga0182033_103115673 | 3300016319 | Soil | GVFELIARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0182038_107536642 | 3300016445 | Soil | TVRSRAGVFELIARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0184612_102003882 | 3300018078 | Groundwater Sediment | RTMGFTVRSPAGVFEVTAKPRVVPAEDIHAVAASLIAMLRGTATGIAVG |
| Ga0190265_124862602 | 3300018422 | Soil | VRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0184649_11749652 | 3300020068 | Groundwater Sediment | RAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0179594_102295152 | 3300020170 | Vadose Zone Soil | GVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0224452_10884952 | 3300022534 | Groundwater Sediment | TMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0207642_104722211 | 3300025899 | Miscanthus Rhizosphere | RGSAGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0207684_109852852 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTARPRVVPAEDIHTVAASLIAMLRRETAGIVVG |
| Ga0207662_103449221 | 3300025918 | Switchgrass Rhizosphere | MGFTVRSRAGVFELTAKPRVVPAEDIHTVASSLIAMLRREMAGIVVG |
| Ga0207701_110749732 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | SRVGVFELMARPRVVRAEDIHMVAASLIAMLRRETAGIVIG |
| Ga0257173_10364522 | 3300026360 | Soil | AFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0209896_10396261 | 3300027006 | Groundwater Sand | PRGSAGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0209869_10070952 | 3300027187 | Groundwater Sand | MGFTVRSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0209465_102319752 | 3300027874 | Tropical Forest Soil | PPRGTVGRTMGFTVRSRAGVFELTARPRVVPAEDIHTVAASLIAMLRRETTGIVIG |
| Ga0209465_105382791 | 3300027874 | Tropical Forest Soil | VMRPPRGSTGRTMGFTARSRAGVFELMARPRVVRAEDIHTVAASLIAMLRRENAGIVVG |
| Ga0207428_106935301 | 3300027907 | Populus Rhizosphere | TMGFTVRSRVGVFELMARPRVVRAEDIHMVAASLIAMLRRETAGIVIG |
| Ga0247828_108211952 | 3300028587 | Soil | VNPIVRSRVGVFELMARPRVVRAADIHMVAASLIAMLRRETAGIVIG |
| Ga0318574_102813061 | 3300031680 | Soil | MGFTVRSRAGVFELMARPRVVRAEDIHTVAASLVAMLRRENAGIVVG |
| Ga0307468_1008978652 | 3300031740 | Hardwood Forest Soil | SRAGDFELTARPRVVPSEDIHTVAASLIAMLRREAAGIVVG |
| Ga0306918_102878103 | 3300031744 | Soil | RGSVGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLVAMLRRENAGIVVG |
| Ga0318535_100843761 | 3300031764 | Soil | FELIARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0318498_103329141 | 3300031778 | Soil | GSVGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLVAMLRRENAGIVVG |
| Ga0318547_109485131 | 3300031781 | Soil | PRGSVGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLVAMLRRENAGIVVG |
| Ga0307473_110242761 | 3300031820 | Hardwood Forest Soil | RAGVFELTARPRVVPAEDIHTVAASLIAMLRRETAGIVVG |
| Ga0310900_104086851 | 3300031908 | Soil | FTVRSRAGVFELIARPRVVRAEDIQTVAASLLAMLRRENAGIVVG |
| Ga0310899_106826772 | 3300032017 | Soil | VMRPPRGSAGRTMGFTVRSRAGVFELIARPRVVRAEDIHTVAASLLAMLRRENAGIVVG |
| Ga0318559_103034323 | 3300032039 | Soil | VMRPPRGSVGRTMGFTVRSRAGVFELMARPRVVRAEDIHTVAASLVAMLRRENAGIVVG |
| Ga0318518_101260061 | 3300032090 | Soil | AGRTMGFTVRSRAGVFELIARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0318518_103958111 | 3300032090 | Soil | RAGVFELMARPRVVRAEDIHTVAASLVAMLRRENAGIVVG |
| Ga0307471_1036346541 | 3300032180 | Hardwood Forest Soil | MGFTVRWRAGVFELMARPRVVRAEDTHTVAASLIPMLRRETAGIVIG |
| Ga0310914_104831081 | 3300033289 | Soil | VFELMARPRVVRAEDIHTVAASLVAMLRRENAGIVVG |
| Ga0326726_123682201 | 3300033433 | Peat Soil | RESAGRTMGFTVRSRAGVFELTARPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0247830_109593531 | 3300033551 | Soil | FELMSRPRVVRAEDIHTVAASLIAMLRRETAGIVIG |
| Ga0314864_0219928_280_423 | 3300033805 | Peatland | MGFTVRSRAGVFELTARPRVVPAEDVHTVAASLIAMLRRETAGIVIG |
| ⦗Top⦘ |