


| Basic Information | |
|---|---|
| Family ID | F100766 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TIVYPAGYEIRDREYRLVGNPTIPRDVVRAALHEMSRFYR |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.16 % |
| % of genes from short scaffolds (< 2000 bps) | 86.27 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.392 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 5.88% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF11893 | DUF3413 | 33.33 |
| PF02096 | 60KD_IMP | 9.80 |
| PF08450 | SGL | 1.96 |
| PF00753 | Lactamase_B | 1.96 |
| PF13537 | GATase_7 | 1.96 |
| PF07578 | LAB_N | 0.98 |
| PF13586 | DDE_Tnp_1_2 | 0.98 |
| PF03544 | TonB_C | 0.98 |
| PF07978 | NIPSNAP | 0.98 |
| PF14849 | YidC_periplas | 0.98 |
| PF10081 | Abhydrolase_9 | 0.98 |
| PF13522 | GATase_6 | 0.98 |
| PF01594 | AI-2E_transport | 0.98 |
| PF00296 | Bac_luciferase | 0.98 |
| PF00691 | OmpA | 0.98 |
| PF00933 | Glyco_hydro_3 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF00884 | Sulfatase | 0.98 |
| PF00561 | Abhydrolase_1 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 9.80 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.96 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.96 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.98 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.98 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.98 |
| COG3952 | Uncharacterized N-terminal domain of lipid-A-disaccharide synthase | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.12 % |
| Unclassified | root | N/A | 5.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01EESGN | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 2199352025|deepsgr__Contig_14728 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104550317 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300000955|JGI1027J12803_101887207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
| 3300000956|JGI10216J12902_101877699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2319 | Open in IMG/M |
| 3300000956|JGI10216J12902_109956987 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300004062|Ga0055500_10005804 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300005172|Ga0066683_10293410 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300005218|Ga0068996_10009561 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300005444|Ga0070694_100011433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5497 | Open in IMG/M |
| 3300005446|Ga0066686_10742753 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005467|Ga0070706_100078774 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300005468|Ga0070707_101942359 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005518|Ga0070699_100748579 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005540|Ga0066697_10506369 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005546|Ga0070696_101503418 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005558|Ga0066698_10880819 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005764|Ga0066903_106703238 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006797|Ga0066659_10358358 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300006852|Ga0075433_11120034 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006904|Ga0075424_102681357 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300007255|Ga0099791_10091176 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300007255|Ga0099791_10233382 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300009012|Ga0066710_104265177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300009038|Ga0099829_10006722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7128 | Open in IMG/M |
| 3300009038|Ga0099829_11632724 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009088|Ga0099830_10353702 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300009088|Ga0099830_10486315 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300009089|Ga0099828_10014712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5943 | Open in IMG/M |
| 3300009137|Ga0066709_100870365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1311 | Open in IMG/M |
| 3300009147|Ga0114129_10991155 | Not Available | 1059 | Open in IMG/M |
| 3300009837|Ga0105058_1142865 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010046|Ga0126384_10137827 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300010336|Ga0134071_10171949 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300010337|Ga0134062_10673032 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010362|Ga0126377_13004473 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010366|Ga0126379_12622252 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
| 3300010373|Ga0134128_11868111 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010376|Ga0126381_101518728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 968 | Open in IMG/M |
| 3300012189|Ga0137388_10678376 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012201|Ga0137365_10170138 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300012201|Ga0137365_11034296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300012209|Ga0137379_10528693 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300012354|Ga0137366_10250686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1312 | Open in IMG/M |
| 3300012354|Ga0137366_10439502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 947 | Open in IMG/M |
| 3300012356|Ga0137371_10805462 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012362|Ga0137361_10555101 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300012362|Ga0137361_10812840 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300012922|Ga0137394_10040183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3832 | Open in IMG/M |
| 3300012922|Ga0137394_10733359 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012922|Ga0137394_11469744 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012930|Ga0137407_10323020 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012944|Ga0137410_10159431 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300012944|Ga0137410_10221915 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300012944|Ga0137410_10841985 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012948|Ga0126375_11955750 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 517 | Open in IMG/M |
| 3300012976|Ga0134076_10342608 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300013001|Ga0157365_10182720 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300014882|Ga0180069_1133905 | Not Available | 602 | Open in IMG/M |
| 3300014883|Ga0180086_1190912 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300015372|Ga0132256_103080284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
| 3300015373|Ga0132257_100036273 | All Organisms → cellular organisms → Bacteria | 5400 | Open in IMG/M |
| 3300018071|Ga0184618_10058882 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300018077|Ga0184633_10190120 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300018079|Ga0184627_10106048 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300019872|Ga0193754_1020790 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300019881|Ga0193707_1075127 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300019882|Ga0193713_1006464 | All Organisms → cellular organisms → Bacteria | 3653 | Open in IMG/M |
| 3300019997|Ga0193711_1005008 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300021063|Ga0206227_1116278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
| 3300022534|Ga0224452_1051244 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300024330|Ga0137417_1305922 | All Organisms → cellular organisms → Bacteria | 3897 | Open in IMG/M |
| 3300025167|Ga0209642_10126778 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300025549|Ga0210094_1019655 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300026313|Ga0209761_1304406 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026315|Ga0209686_1191538 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300026317|Ga0209154_1308342 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026318|Ga0209471_1013331 | All Organisms → cellular organisms → Bacteria | 4262 | Open in IMG/M |
| 3300026538|Ga0209056_10593272 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300027181|Ga0208997_1028026 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300027655|Ga0209388_1214682 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027846|Ga0209180_10460297 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300027875|Ga0209283_10422559 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300027882|Ga0209590_10304336 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300028380|Ga0268265_10047075 | All Organisms → cellular organisms → Bacteria | 3229 | Open in IMG/M |
| 3300028381|Ga0268264_11859292 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300028536|Ga0137415_10823085 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 739 | Open in IMG/M |
| 3300028784|Ga0307282_10257350 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300028828|Ga0307312_10009120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5435 | Open in IMG/M |
| 3300028828|Ga0307312_10810503 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031184|Ga0307499_10246056 | Not Available | 569 | Open in IMG/M |
| 3300031720|Ga0307469_10191407 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300031873|Ga0315297_11039843 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300032174|Ga0307470_10871433 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300032180|Ga0307471_100298213 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300032180|Ga0307471_101527078 | Not Available | 825 | Open in IMG/M |
| 3300032205|Ga0307472_101614159 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300032516|Ga0315273_10665451 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300033500|Ga0326730_1015882 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300034178|Ga0364934_0409962 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.98% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013001 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM3 | Host-Associated | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_07770380 | 2189573000 | Grass Soil | LPSSYEIRDRNYRLVPKPTLPRDVVQAALREMSRFYR |
| deepsgr_02417030 | 2199352025 | Soil | VTVVLPSSYEIRDRNYRLVPKPTLPRDVVQAALKEMSRFYR |
| INPhiseqgaiiFebDRAFT_1045503171 | 3300000364 | Soil | VVFPAGYEIRDRSYRLVANPTLPRDGLRAAMHEMSRFYR* |
| JGI1027J12803_1018872072 | 3300000955 | Soil | PAGYEIRDRRDRLETHPTLPRDALRSAVQEMSRFYR* |
| JGI10216J12902_1018776993 | 3300000956 | Soil | VVLQDAYEIRDANYRLVRHPTLPRDGLRAALREMSRFYK* |
| JGI10216J12902_1099569871 | 3300000956 | Soil | VHPAGYEIRDRDYRLVGHPTIPRDVVRAALHEMRRFDR* |
| Ga0055500_100058042 | 3300004062 | Natural And Restored Wetlands | TIVYPASYEIRDRDYRLVAHPMLPRDSLRAAQREMSRFFR* |
| Ga0066683_102934101 | 3300005172 | Soil | TIVYPAGYEIRDREYRLVGNPTIPRDVVRAALHEMSRFYR* |
| Ga0068996_100095612 | 3300005218 | Natural And Restored Wetlands | TIVYPASYEIRDRDYRLVAHPTPPRDSLRAAQKEMSRFFR* |
| Ga0070694_1000114336 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VTIVYPASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR* |
| Ga0066686_107427531 | 3300005446 | Soil | IVHPAGYEIRDREYRLVANPTIPREVVRAALHEMSRFYR* |
| Ga0070706_1000787743 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LIEPERVTIVYPAGYEIRDRDYGLVRNPTIPRDVVRPALHEMSRFYR* |
| Ga0070707_1019423592 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TVVFPAGYEIRDRSYRLVANPTFPRDGLRAALHEMSRFYR* |
| Ga0070699_1007485791 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LIEPDRVTVVFPAGYEIRDQSYRLVANPTLPRDGLRAAMHEMSRFYR* |
| Ga0066697_105063692 | 3300005540 | Soil | TIVYPAGYEIRDREYRLVGNPTIPRAVVRAALHEMSRFYR* |
| Ga0070696_1015034182 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EPERLIIIRPSGQEVRDRTYRLVANPTLPRDALQAALREMSRFSR* |
| Ga0066698_108808192 | 3300005558 | Soil | VIEPERVTVIYPASYEIRDRSYRLVPNPTVPRDVLRGALQEMSRFY |
| Ga0066903_1067032381 | 3300005764 | Tropical Forest Soil | RVIVVLPAGYEIRDRTYRLVSNPALPRDALRAAMREMSRFYR* |
| Ga0066659_103583581 | 3300006797 | Soil | GYEIRDRNYRLVQKPKIPHDALRAALQEMRRFYR* |
| Ga0075433_111200342 | 3300006852 | Populus Rhizosphere | TIVYPAGYQIRDRDYRLVRNPTIPREVVRAALHEMSRFYR* |
| Ga0075424_1026813571 | 3300006904 | Populus Rhizosphere | LQDAYEVRDGNYRLLPHPTLPRDGLRAALREMSRFYK* |
| Ga0099791_100911762 | 3300007255 | Vadose Zone Soil | TVVFPAGYEIRDRSYRLVANPTLPRDGLRAAMHEMSRFYR* |
| Ga0099791_102333821 | 3300007255 | Vadose Zone Soil | PAGYEIRDREYRLVANPTIPRDVVRAALHEMSRFYR* |
| Ga0066710_1042651772 | 3300009012 | Grasslands Soil | GGYEIRDENYRLVRHPTLPQESLRAALREMSRFYR |
| Ga0099829_100067227 | 3300009038 | Vadose Zone Soil | IVYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR* |
| Ga0099829_116327241 | 3300009038 | Vadose Zone Soil | VTVVFPSGYEIRDRNYRLVSNPTFPRESLRAAGHTMRRFYR* |
| Ga0099830_103537021 | 3300009088 | Vadose Zone Soil | IVYPASYEIRDRDYRLVAHPTFPRAGLGAAQQEMSRFFR* |
| Ga0099830_104863152 | 3300009088 | Vadose Zone Soil | IEPERVTIVYPAGYEIRARDYRLVGHPTIPREVVRAALHEMSRFYR* |
| Ga0099828_100147126 | 3300009089 | Vadose Zone Soil | TIVYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR* |
| Ga0099828_112237002 | 3300009089 | Vadose Zone Soil | SRGYEIRDENYRLILHATFPQERLRAALREMSRFYR* |
| Ga0066709_1008703653 | 3300009137 | Grasslands Soil | LIEPDRITVVFPAGYEIRDRNYRLLQHPTLPRDGLRAALHEMSRFYR* |
| Ga0114129_109911551 | 3300009147 | Populus Rhizosphere | TVVFRSGYEIRDGRYRLLPHPTLPRDLVRSAMHEMSRFYR* |
| Ga0105058_11428651 | 3300009837 | Groundwater Sand | SYEIRDRSYRLVPKPTIPRDALRAALQEMSRFYR* |
| Ga0126384_101378273 | 3300010046 | Tropical Forest Soil | VTLVLPAGYEIRDRRYRLMTHPALPREALRSAVQEMSRFYR* |
| Ga0134071_101719492 | 3300010336 | Grasslands Soil | FALIEPGRVTVVFPSGYEIRDGNYRLVPNPTLPRGLVRDAMHEMSRFYR* |
| Ga0134062_106730321 | 3300010337 | Grasslands Soil | VTIAYPAGYEIRDRNYRLVQKPKIPHDALRAALQEMRRFYR* |
| Ga0126377_130044731 | 3300010362 | Tropical Forest Soil | SYRDYALVDPERVTLVLPAGYEIRDRRYRLMTHPALPREALRSAVQEMSRFYR* |
| Ga0126379_126222521 | 3300010366 | Tropical Forest Soil | IEPDRVTVVFGSGYEIRDRRYRLVPNPTLPRDLLRAAMHEMSRFYR* |
| Ga0134128_118681112 | 3300010373 | Terrestrial Soil | EFALIEPERVTIVYPASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR* |
| Ga0126381_1015187283 | 3300010376 | Tropical Forest Soil | FGSGYEIRDGRYQLVPNPTLPRDLLRSAMHEMSRFYR* |
| Ga0137388_106783762 | 3300012189 | Vadose Zone Soil | GYEIRDRSYRLVANPTLPRDGLRAALHEMSRFYR* |
| Ga0137365_101701382 | 3300012201 | Vadose Zone Soil | VTIVYPAGYEIRDREYRLVGNPTIPRDVVRAALHEMSRFYR* |
| Ga0137365_110342961 | 3300012201 | Vadose Zone Soil | LIEPERVTIVRPNGYEIRDRGYRLIPNPTVPRDVVRAALHEMRRFYR* |
| Ga0137379_105286931 | 3300012209 | Vadose Zone Soil | DYALLEAERVTIVYPAGYEIRDRDYRLIEHPTLPRESLRAALGEMSRFYR* |
| Ga0137366_102506862 | 3300012354 | Vadose Zone Soil | VTVVFQDAYEVRDGNYRLVPNPTLPRDGLRAALREMSRFYK* |
| Ga0137366_104395021 | 3300012354 | Vadose Zone Soil | IVSPTSYELRDRKYRLIPNPAPPRDHLRAAMHEMRRFYR* |
| Ga0137371_108054621 | 3300012356 | Vadose Zone Soil | PERVTIIRQNGYEIRDKNYRLLQNPKLPQENLPAAMQEMRRFYR* |
| Ga0137360_117940521 | 3300012361 | Vadose Zone Soil | PVNGYEIRDREYRLIPSPTVPRDVVRAALHEMRRFYR* |
| Ga0137361_105551012 | 3300012362 | Vadose Zone Soil | GYEIRDREYRLVANPTIPRDVVRAALHEMSRFYR* |
| Ga0137361_108128402 | 3300012362 | Vadose Zone Soil | GYEIRDENYRLVRHPTLPQESLRAALREMSRFYR* |
| Ga0137394_100401834 | 3300012922 | Vadose Zone Soil | ASYEIRDRDYRLVTHSTLPREDLRAAQKEMSRFYR* |
| Ga0137394_107333592 | 3300012922 | Vadose Zone Soil | SYEIRDRDYRLVGHPTFPRDGLRAAQQEMSRFFR* |
| Ga0137394_114697441 | 3300012922 | Vadose Zone Soil | PDRITVVFPAGYEIRDRNYRLLQHPTLPRDGLRAALHEMSRFYR* |
| Ga0137407_103230201 | 3300012930 | Vadose Zone Soil | PASYEIRDRDYRLVAHPTFPHDGLRAAQQEMSRFFR* |
| Ga0137410_101594312 | 3300012944 | Vadose Zone Soil | YPASYEIRDRDYRMVVHPTFPRDGPRAAQQEMSRFYR* |
| Ga0137410_102219151 | 3300012944 | Vadose Zone Soil | PERVTIVYPAGYEIRDGDYRRVRKPTIPREVARAALREMSRFYR* |
| Ga0137410_108419852 | 3300012944 | Vadose Zone Soil | AGYEIRDRDYRLVRNPTLPRDGLRAAMQEMSRFYR* |
| Ga0126375_119557501 | 3300012948 | Tropical Forest Soil | DRVTVVFPSGYEIRDRNYRLVPKPTLSRDELTAAMQEMGRFYR* |
| Ga0134076_103426082 | 3300012976 | Grasslands Soil | IEPERVTIVYSAGYEIRDGDYRLVRNPTIPRDVVRAALHEISRFYR* |
| Ga0157365_101827202 | 3300013001 | Fungus Garden | LEPDQVTIVYPASYEIRDRSYRLVRNPSLPREALREAQKEMSRFYR* |
| Ga0180069_11339051 | 3300014882 | Soil | ASYEVRDRNYRLVPNPTLPRDSLRAAMHEMRRFYR* |
| Ga0180086_11909122 | 3300014883 | Soil | PDRVTVVLPGGYEIRDRNYRLVSNPALPRDGLRAALHEMSRFYR* |
| Ga0132256_1030802842 | 3300015372 | Arabidopsis Rhizosphere | PSSYEIRDRNYRLVPKPALPRDVMQAALREMSRFYR* |
| Ga0132257_1000362731 | 3300015373 | Arabidopsis Rhizosphere | PDRVTVVLPSSYEIRDRNYRLVPKPTLPRDVVQAALKEMSRFYR* |
| Ga0184618_100588822 | 3300018071 | Groundwater Sediment | ERVTLLSPASYEIRDLDYRLVAHPTFPHDGLRAAQQEMSRFFR |
| Ga0184633_101901202 | 3300018077 | Groundwater Sediment | RPNGYEIRDRGYRLVQNPQLPNASLRAALQEMRRFYRQ |
| Ga0184627_101060482 | 3300018079 | Groundwater Sediment | TVVYPAGYEIRDQNYRLVRNPKLSRDVVRAALHEMSRFYR |
| Ga0193754_10207901 | 3300019872 | Soil | LIEPERVTIVYSASYEIRDRDYRLVTHPILPREDLRAAQKEMSRFYR |
| Ga0193707_10751271 | 3300019881 | Soil | IVYPASYEIRDRDYRLVAHPTFPRDGLRAAQQEMSRFYR |
| Ga0193713_10064641 | 3300019882 | Soil | EFALLQPERVTIVYPASYEIRDRDYRLVAHPTFPHDGLRAAQQEMSRFFR |
| Ga0193711_10050082 | 3300019997 | Soil | RVTIVYSASYEIRDRDYRLVTHPILPREDLRAAQKEMSRFYR |
| Ga0206227_11162782 | 3300021063 | Deep Subsurface Sediment | VAIVYPASYEIRDQNYRLVPNPTLPRDGLRAGLHEMRRLYR |
| Ga0224452_10512442 | 3300022534 | Groundwater Sediment | YPASYEIRDRDYRLVAHPTFPHDGLRAAQQEMSRFFR |
| Ga0137417_13059222 | 3300024330 | Vadose Zone Soil | VTVVYPASYEIRDREYRLVAHPTFPRAGLGAAQQEMSRFFR |
| Ga0209642_101267781 | 3300025167 | Soil | IEQERVTIVRPNGYEIRDRNYRLVPKPQLPNAGLRAALAEMRRFYR |
| Ga0210094_10196551 | 3300025549 | Natural And Restored Wetlands | PERVTIVYPASYEIRDRDYRLVAHPTPPRDSLRAAQREMSRFFR |
| Ga0209761_13044062 | 3300026313 | Grasslands Soil | VIIVHPAGYEIRDREYRLVANPTIPREVVRAALHEMSRFYR |
| Ga0209686_11915382 | 3300026315 | Soil | DYALIEPERVIIVHPAGYEIRDREYRLVANPTIPREVVRAALHEMSRFYR |
| Ga0209154_13083422 | 3300026317 | Soil | VTIVYPAGYEIRDGDYRLVRNPTIPRDVVRAALHEMSRFYR |
| Ga0209471_10133311 | 3300026318 | Soil | VVLAGGYEIRDENYRLVRHPTLPQESLRAALREMSRFYR |
| Ga0209056_105932722 | 3300026538 | Soil | DFALIEPDRVTIAYPADYEIRDRDYRLVQNPRIPHDGLRAALREMRRFYR |
| Ga0208997_10280261 | 3300027181 | Forest Soil | VTIVYPASYEIRDRDYRLVAHPTFPRDGLRAAQQEMSRFYR |
| Ga0209388_12146822 | 3300027655 | Vadose Zone Soil | RVTIVYPAGYEIRDREYRLVANPTIPRDVVRAALHEMSRFYR |
| Ga0209180_104602971 | 3300027846 | Vadose Zone Soil | IVYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR |
| Ga0209283_104225591 | 3300027875 | Vadose Zone Soil | VYPAGYEIRDRDYRLVGHPTIPREVVRAALHEMSRFYR |
| Ga0209590_103043361 | 3300027882 | Vadose Zone Soil | IVYRAGIEIRDQNYRLVQNPTLPRDRLRAALQEMSRFYR |
| Ga0268265_100470754 | 3300028380 | Switchgrass Rhizosphere | ERVTIVYPASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR |
| Ga0268264_118592922 | 3300028381 | Switchgrass Rhizosphere | PASYEIRDRAYRLVAHPTLPREGLRGAQKEMSRFYR |
| Ga0137415_108230852 | 3300028536 | Vadose Zone Soil | EPDRITVVFPAGYEIRDRNYRLLQNPTLPRDGLRAALHEMSRFYR |
| Ga0307282_102573501 | 3300028784 | Soil | LIEPERVTIVYPASYEIRDRAYRLVAHPALPRDSLRAAQKEMNRFFR |
| Ga0307312_100091206 | 3300028828 | Soil | LEPERVTIVYPASYEIRDRDYRLVAHPTFPRDALRAAQQEMSRFYR |
| Ga0307312_108105032 | 3300028828 | Soil | VWRREGGYPTGYEIRDRDYRLVRNPTIPRDVVRAARHEKSPFYR |
| Ga0307499_102460562 | 3300031184 | Soil | YPSGYEIRDQNYRLVQNPQPSRDHLRAAMQEMRRFYR |
| Ga0307469_101914072 | 3300031720 | Hardwood Forest Soil | LEPERVTIVYPASYEIRDRDYRLVARPTLPRDGLRAAQQEMSRFYR |
| Ga0315297_110398432 | 3300031873 | Sediment | VAIVHSASYEIRDQNYRLVPDPTLPRDGLRAALHEMRR |
| Ga0307470_108714332 | 3300032174 | Hardwood Forest Soil | RVTIAYPAGYEIRDRDYRLVQNPRIPHEGLGAALREMRRFYR |
| Ga0307471_1002982131 | 3300032180 | Hardwood Forest Soil | LIEPDRVTVVLPSSYEIRDRNYRLVPKPTLPRDVVQAALKEMSRFYR |
| Ga0307471_1015270781 | 3300032180 | Hardwood Forest Soil | PSGYEIRDQNYRLVQNPQPSRDHLRAAMQEMRRFYR |
| Ga0307472_1016141591 | 3300032205 | Hardwood Forest Soil | GAGYEVRDRDYRLVAHPTLFRDGLRAAQKEMSRFYR |
| Ga0315273_106654511 | 3300032516 | Sediment | IVRPNGYEIRDRNYRLVQNPQLPSAGLRAALKEMRRFYR |
| Ga0326730_10158823 | 3300033500 | Peat Soil | FALVEPDQVTIVSPTSYEIRDRNYRLIPDPTLPRDRLRAAMHEMRRFYR |
| Ga0364934_0409962_1_123 | 3300034178 | Sediment | IVRPNGYEIRDRGYRLVQNPQLPNASLRAALQEMRRFYRQ |
| ⦗Top⦘ |