


| Basic Information | |
|---|---|
| Family ID | F100715 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTKDECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 91.18 % |
| % of genes near scaffold ends (potentially truncated) | 14.71 % |
| % of genes from short scaffolds (< 2000 bps) | 64.71 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.863 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (24.510 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.686 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.745 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 90.91% β-sheet: 0.00% Coil/Unstructured: 9.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00476 | DNA_pol_A | 6.86 |
| PF11753 | DUF3310 | 5.88 |
| PF00145 | DNA_methylase | 5.88 |
| PF00692 | dUTPase | 4.90 |
| PF01612 | DNA_pol_A_exo1 | 3.92 |
| PF04851 | ResIII | 2.94 |
| PF08774 | VRR_NUC | 2.94 |
| PF01870 | Hjc | 0.98 |
| PF02511 | Thy1 | 0.98 |
| PF01555 | N6_N4_Mtase | 0.98 |
| PF13884 | Peptidase_S74 | 0.98 |
| PF13392 | HNH_3 | 0.98 |
| PF12637 | TSCPD | 0.98 |
| PF03592 | Terminase_2 | 0.98 |
| PF03237 | Terminase_6N | 0.98 |
| PF10991 | DUF2815 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 6.86 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 5.88 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 4.90 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 4.90 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.98 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.98 |
| COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.98 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.98 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.86 % |
| All Organisms | root | All Organisms | 43.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2200019238 | All Organisms → cellular organisms → Bacteria | 2842 | Open in IMG/M |
| 3300000052|Draft_c140155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2651 | Open in IMG/M |
| 3300001275|B570J13894_1001367 | All Organisms → cellular organisms → Bacteria | 2845 | Open in IMG/M |
| 3300001849|RCM26_1009979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
| 3300002361|B570J29637_1008769 | Not Available | 601 | Open in IMG/M |
| 3300002386|B570J29613_1002025 | Not Available | 1824 | Open in IMG/M |
| 3300002835|B570J40625_100007433 | All Organisms → cellular organisms → Bacteria | 20159 | Open in IMG/M |
| 3300002835|B570J40625_100101315 | Not Available | 3553 | Open in IMG/M |
| 3300002835|B570J40625_100360685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 1435 | Open in IMG/M |
| 3300002835|B570J40625_100476796 | Not Available | 1181 | Open in IMG/M |
| 3300004240|Ga0007787_10074128 | All Organisms → Viruses → Predicted Viral | 1557 | Open in IMG/M |
| 3300004240|Ga0007787_10323478 | Not Available | 764 | Open in IMG/M |
| 3300006802|Ga0070749_10115587 | Not Available | 1578 | Open in IMG/M |
| 3300006803|Ga0075467_10569226 | Not Available | 580 | Open in IMG/M |
| 3300006805|Ga0075464_10366304 | Not Available | 873 | Open in IMG/M |
| 3300006805|Ga0075464_10713013 | Not Available | 621 | Open in IMG/M |
| 3300006875|Ga0075473_10386258 | Not Available | 566 | Open in IMG/M |
| 3300007540|Ga0099847_1109807 | Not Available | 836 | Open in IMG/M |
| 3300007540|Ga0099847_1161220 | Not Available | 664 | Open in IMG/M |
| 3300007973|Ga0105746_1267387 | Not Available | 590 | Open in IMG/M |
| 3300007974|Ga0105747_1330420 | Not Available | 520 | Open in IMG/M |
| 3300009085|Ga0105103_10298275 | Not Available | 878 | Open in IMG/M |
| 3300009151|Ga0114962_10005503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis | 9915 | Open in IMG/M |
| 3300009151|Ga0114962_10020486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4682 | Open in IMG/M |
| 3300009151|Ga0114962_10090434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 1923 | Open in IMG/M |
| 3300009151|Ga0114962_10240209 | Not Available | 1037 | Open in IMG/M |
| 3300009151|Ga0114962_10416657 | Not Available | 724 | Open in IMG/M |
| 3300009152|Ga0114980_10007029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7385 | Open in IMG/M |
| 3300009152|Ga0114980_10007164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis | 7312 | Open in IMG/M |
| 3300009152|Ga0114980_10045159 | All Organisms → Viruses → Predicted Viral | 2685 | Open in IMG/M |
| 3300009152|Ga0114980_10542266 | Not Available | 660 | Open in IMG/M |
| 3300009154|Ga0114963_10259569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300009158|Ga0114977_10007937 | Not Available | 6730 | Open in IMG/M |
| 3300009158|Ga0114977_10547738 | Not Available | 629 | Open in IMG/M |
| 3300009159|Ga0114978_10247886 | Not Available | 1107 | Open in IMG/M |
| 3300009180|Ga0114979_10198141 | Not Available | 1217 | Open in IMG/M |
| 3300010157|Ga0114964_10066574 | All Organisms → Viruses → Predicted Viral | 1842 | Open in IMG/M |
| 3300010388|Ga0136551_1047760 | Not Available | 782 | Open in IMG/M |
| 3300010388|Ga0136551_1056552 | Not Available | 710 | Open in IMG/M |
| 3300010965|Ga0138308_105102 | Not Available | 9890 | Open in IMG/M |
| 3300010970|Ga0137575_10006032 | All Organisms → Viruses → Predicted Viral | 2208 | Open in IMG/M |
| 3300011009|Ga0129318_10072006 | Not Available | 936 | Open in IMG/M |
| 3300011337|Ga0153702_1019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis | 57354 | Open in IMG/M |
| 3300012352|Ga0157138_1019632 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300014711|Ga0134314_100887 | All Organisms → Viruses → Predicted Viral | 2583 | Open in IMG/M |
| 3300014962|Ga0134315_1004557 | All Organisms → Viruses → Predicted Viral | 2370 | Open in IMG/M |
| 3300017707|Ga0181363_1074494 | Not Available | 585 | Open in IMG/M |
| 3300017747|Ga0181352_1004689 | All Organisms → cellular organisms → Bacteria | 4682 | Open in IMG/M |
| 3300017747|Ga0181352_1051743 | Not Available | 1193 | Open in IMG/M |
| 3300017747|Ga0181352_1108041 | Not Available | 759 | Open in IMG/M |
| 3300017754|Ga0181344_1019490 | All Organisms → Viruses → Predicted Viral | 2114 | Open in IMG/M |
| 3300017754|Ga0181344_1044988 | All Organisms → Viruses → Predicted Viral | 1324 | Open in IMG/M |
| 3300017785|Ga0181355_1181090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pelistega → Pelistega indica | 837 | Open in IMG/M |
| 3300017785|Ga0181355_1333591 | Not Available | 561 | Open in IMG/M |
| 3300020048|Ga0207193_1000773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis | 57344 | Open in IMG/M |
| 3300020048|Ga0207193_1030440 | Not Available | 6263 | Open in IMG/M |
| 3300020048|Ga0207193_1421612 | Not Available | 889 | Open in IMG/M |
| 3300020493|Ga0208591_1000108 | Not Available | 10803 | Open in IMG/M |
| 3300020513|Ga0208090_1003319 | All Organisms → Viruses → Predicted Viral | 2917 | Open in IMG/M |
| 3300020513|Ga0208090_1017216 | Not Available | 1081 | Open in IMG/M |
| 3300020513|Ga0208090_1017527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300020517|Ga0208854_1008576 | All Organisms → Viruses → Predicted Viral | 1816 | Open in IMG/M |
| 3300020517|Ga0208854_1019088 | Not Available | 1032 | Open in IMG/M |
| 3300020519|Ga0208223_1003009 | All Organisms → Viruses → Predicted Viral | 3328 | Open in IMG/M |
| 3300020524|Ga0208858_1034627 | Not Available | 710 | Open in IMG/M |
| 3300022061|Ga0212023_1059346 | Not Available | 531 | Open in IMG/M |
| 3300022072|Ga0196889_1068838 | Not Available | 669 | Open in IMG/M |
| 3300022179|Ga0181353_1052947 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
| 3300022179|Ga0181353_1075192 | Not Available | 858 | Open in IMG/M |
| 3300022179|Ga0181353_1092458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300025635|Ga0208147_1069091 | Not Available | 883 | Open in IMG/M |
| 3300025896|Ga0208916_10535350 | Not Available | 510 | Open in IMG/M |
| 3300027693|Ga0209704_1008819 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
| 3300027733|Ga0209297_1001058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis | 16142 | Open in IMG/M |
| 3300027733|Ga0209297_1003490 | Not Available | 8399 | Open in IMG/M |
| 3300027733|Ga0209297_1008519 | Not Available | 5083 | Open in IMG/M |
| 3300027749|Ga0209084_1001290 | All Organisms → cellular organisms → Bacteria | 21427 | Open in IMG/M |
| 3300027749|Ga0209084_1004105 | Not Available | 10348 | Open in IMG/M |
| 3300027749|Ga0209084_1040335 | Not Available | 2320 | Open in IMG/M |
| 3300027749|Ga0209084_1053405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 1931 | Open in IMG/M |
| 3300027763|Ga0209088_10220871 | Not Available | 801 | Open in IMG/M |
| 3300027808|Ga0209354_10392483 | Not Available | 541 | Open in IMG/M |
| 3300027900|Ga0209253_10368507 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300027973|Ga0209298_10001030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18482 | Open in IMG/M |
| 3300027973|Ga0209298_10009144 | Not Available | 5363 | Open in IMG/M |
| 3300033521|Ga0316616_102922039 | Not Available | 644 | Open in IMG/M |
| 3300033996|Ga0334979_0314631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300033996|Ga0334979_0355506 | Not Available | 819 | Open in IMG/M |
| 3300034013|Ga0334991_0400950 | Not Available | 527 | Open in IMG/M |
| 3300034022|Ga0335005_0128275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 1631 | Open in IMG/M |
| 3300034023|Ga0335021_0302848 | Not Available | 857 | Open in IMG/M |
| 3300034023|Ga0335021_0502121 | Not Available | 616 | Open in IMG/M |
| 3300034064|Ga0335001_0076449 | All Organisms → Viruses → Predicted Viral | 1925 | Open in IMG/M |
| 3300034071|Ga0335028_0000514 | Not Available | 28395 | Open in IMG/M |
| 3300034095|Ga0335022_0326281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300034096|Ga0335025_0033679 | All Organisms → Viruses → Predicted Viral | 3460 | Open in IMG/M |
| 3300034096|Ga0335025_0321432 | Not Available | 822 | Open in IMG/M |
| 3300034107|Ga0335037_0590784 | Not Available | 587 | Open in IMG/M |
| 3300034118|Ga0335053_0629104 | Not Available | 614 | Open in IMG/M |
| 3300034272|Ga0335049_0644139 | Not Available | 650 | Open in IMG/M |
| 3300034355|Ga0335039_0017746 | All Organisms → Viruses → Predicted Viral | 4439 | Open in IMG/M |
| 3300034355|Ga0335039_0025183 | All Organisms → Viruses → Predicted Viral | 3684 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 24.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 15.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.73% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.78% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 2.94% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.96% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 1.96% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.98% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.98% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.98% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300000052 | Coal bed methane well microbial communities from Alberta, Canada | Engineered | Open in IMG/M |
| 3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300002361 | Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002386 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020517 | Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200229260 | 2199352005 | Freshwater | MTKEELYKRLTMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Draft_1401556 | 3300000052 | Hydrocarbon Resource Environments | MTKDEVYNRLQMAQKNKKEIKKVKLDLLKEIQQLKLMLRALEEEEQWVN* |
| B570J13894_10013676 | 3300001275 | Freshwater | MTKEELYKRLTMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| RCM26_10099792 | 3300001849 | Marine Plankton | MTKDELYTRLEEAQKNKKALKKIKLSLLKEIEQFKLMLRALEEEEHG* |
| B570J29637_10087691 | 3300002361 | Freshwater | MTKDECISRLKAAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAS* |
| B570J29613_10020253 | 3300002386 | Freshwater | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAX* |
| B570J40625_10000743315 | 3300002835 | Freshwater | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAN* |
| B570J40625_1001013153 | 3300002835 | Freshwater | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAH* |
| B570J40625_1003606855 | 3300002835 | Freshwater | MTKDEVYSRLQMAQKNKKELKKVKLDLLKEIQQLKLMLRALEEEEQWAN* |
| B570J40625_1004767965 | 3300002835 | Freshwater | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWA |
| Ga0007787_100741283 | 3300004240 | Freshwater Lake | MTKEELYKRLTMAPKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| Ga0007787_103234782 | 3300004240 | Freshwater Lake | MTKEELYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| Ga0070749_101155872 | 3300006802 | Aqueous | MSKDECISRLTMAQKNKKELKKIKLQLLKEIQQLKLMLKALEEEEQWVS* |
| Ga0075467_105692262 | 3300006803 | Aqueous | MTKDECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| Ga0075464_103663043 | 3300006805 | Aqueous | MTKDECFKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| Ga0075464_107130133 | 3300006805 | Aqueous | MSKEELYKRLTMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| Ga0075473_103862582 | 3300006875 | Aqueous | MTKNECMVRLTMAQKNKKELKKIKLQLLKEIQQLKLMLRALEEEEQWVS* |
| Ga0099847_11098071 | 3300007540 | Aqueous | MTKDECLSRLTMVQKNKKELKKIKLQLLKEIQQLKLMLRALEEEEQWVS* |
| Ga0099847_11612201 | 3300007540 | Aqueous | MSKDEIYKRLTMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| Ga0105746_12673872 | 3300007973 | Estuary Water | EMAQKNKKELKKVKLKLLVEIQQLKLMLRAMEEQEVLDG* |
| Ga0105747_13304201 | 3300007974 | Estuary Water | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALDEEEQWVN* |
| Ga0105103_102982755 | 3300009085 | Freshwater Sediment | MTKNEVYKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDGDE* |
| Ga0114962_1000550319 | 3300009151 | Freshwater Lake | MTKEELYKRLEMAQKNKKDLKKVKLKILAEIQQLKLMLRAMEEQEILDGDE* |
| Ga0114962_1002048612 | 3300009151 | Freshwater Lake | MTKEELYKRLTMAQKNKKELKKIKLQILKEIEQLKLMLRALEEEEQWAN* |
| Ga0114962_100904348 | 3300009151 | Freshwater Lake | MTKYEVYNRLQMAQKNKKELKKVKLDLLKEIQQLKLMLRALEEEEQWAN* |
| Ga0114962_102402092 | 3300009151 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKIKLQILKEIEQLKLMLRALEEEEQWVN* |
| Ga0114962_104166572 | 3300009151 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKIKLELLKEIEQLKLMLRALEEG* |
| Ga0114980_1000702911 | 3300009152 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKVKLDLLKEIQQLKLMLRALEEEEQWAN* |
| Ga0114980_1000716416 | 3300009152 | Freshwater Lake | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALDEEEQWAS* |
| Ga0114980_100451594 | 3300009152 | Freshwater Lake | MTKNEVYKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDG* |
| Ga0114980_105422662 | 3300009152 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKIKLQILKEIEQLKLMLRALEEDDCG* |
| Ga0114963_102595692 | 3300009154 | Freshwater Lake | MTKTEMYKRLEMAQKNKKDLKKVKLKILAEIQQLKLMLRAMEEQEILDGDE* |
| Ga0114977_100079378 | 3300009158 | Freshwater Lake | MTKDEVYNRLQMAHKNKKELKKVKLDLLKEIQQLKLMLRALEEEEQWAN* |
| Ga0114977_105477382 | 3300009158 | Freshwater Lake | MTKEELYKRLTMAQKNKKELNKIKLQLLKEIEQLKLMLRALEEEDQWAN* |
| Ga0114978_102478861 | 3300009159 | Freshwater Lake | SKMTKEELYKRLTMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG* |
| Ga0114979_101981411 | 3300009180 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKIKLQILKEIEQLKLMLRALEEG* |
| Ga0114964_100665742 | 3300010157 | Freshwater Lake | MTKTEMYKRLEMAQKNKKDLKKVKLKILAEIQQLKLMLRAMEEQEILDGN* |
| Ga0136551_10477604 | 3300010388 | Pond Fresh Water | MTKDECLSRLTMAQKNKKELKKIKLQLLKEIQQLKLMLR |
| Ga0136551_10565523 | 3300010388 | Pond Fresh Water | MAQKNKKELKKVKLKLLAEIQQLKLMLRAMEEQEVLDG* |
| Ga0138308_1051029 | 3300010965 | Lake Chemocline | MTKDEVYKRLQMAQKNKKELKKIKLQILKEIEQLKLMLRALEEDDCG* |
| Ga0137575_100060323 | 3300010970 | Pond Fresh Water | MTKEEMYKRLEMAQKNKKELKKVKLQLLKEIEQLKLMIRAMEEQEVLDG* |
| Ga0129318_100720062 | 3300011009 | Freshwater To Marine Saline Gradient | MTKDEVYNRLQMAQKNKKEIKKVKLDLLKEIQQLKLMLRALEEEEQWAN* |
| Ga0153702_101920 | 3300011337 | Freshwater | MTRLECMTRLTMAQKNKKELKKIKLQLLKEIQQLKLMLRALEEEEQWVN* |
| Ga0157138_10196322 | 3300012352 | Freshwater | MTKTEMYKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDG* |
| Ga0134314_1008873 | 3300014711 | Surface Water | MTKQELYERLDMAQKNKKELKKLKVQLLKEIEQLKLMVRAMEEQEVLDA* |
| Ga0134315_10045571 | 3300014962 | Surface Water | MTKQELYERLDMAQKNKKELKKLKVQLLKEIEQLKLMVRAMEEQEVLDG* |
| Ga0181363_10744941 | 3300017707 | Freshwater Lake | MTKDECYKRLEMAQKNKKELKKIKLQLLKEIAQLKLMLRALEEG |
| Ga0181352_100468910 | 3300017747 | Freshwater Lake | MTKEECLSRLTTAQKNKNELRKVRLQLLKEIEQLKLMLRALEEEEQWAN |
| Ga0181352_10517433 | 3300017747 | Freshwater Lake | MTKDEVYKRLHMAQKNKKELKKIKLQILKEIEQLKLMLRALEEDDCG |
| Ga0181352_11080411 | 3300017747 | Freshwater Lake | MTNDEMFKRLEMAQKNKKELKKVKLKLLAEIQQLKLMLRAMEEQEVLDG |
| Ga0181344_10194901 | 3300017754 | Freshwater Lake | MTKDEMFKRLEMAQKNKNELKKVKLKLLAEIQQLKLMLRAMEEQEVLDG |
| Ga0181344_10449881 | 3300017754 | Freshwater Lake | MTKNEVYKRLEMAQKNKKELKKVKLKILAEIQQLKLML |
| Ga0181355_11810902 | 3300017785 | Freshwater Lake | MTKDELYKRLTMAQKNKKELRKIKLQLLKEIEQLKLMLRALEEG |
| Ga0181355_13335911 | 3300017785 | Freshwater Lake | ECFKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0207193_100077345 | 3300020048 | Freshwater Lake Sediment | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAS |
| Ga0207193_103044017 | 3300020048 | Freshwater Lake Sediment | MTKTEVYKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDG |
| Ga0207193_14216122 | 3300020048 | Freshwater Lake Sediment | MTKDECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALXXXXXXX |
| Ga0208591_100010814 | 3300020493 | Freshwater | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAN |
| Ga0208090_10033198 | 3300020513 | Freshwater | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAH |
| Ga0208090_10172161 | 3300020513 | Freshwater | MTKDECFKRLEMAQNNKKELKKIKLQLLKEIEQLKLMLRALEES |
| Ga0208090_10175272 | 3300020513 | Freshwater | MTKEELYKRLTTAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0208854_10085762 | 3300020517 | Freshwater | MTKEECFKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0208854_10190881 | 3300020517 | Freshwater | MTKDECISRLKAAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAS |
| Ga0208223_10030098 | 3300020519 | Freshwater | MTKNEVYKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDG |
| Ga0208858_10346274 | 3300020524 | Freshwater | MTKDECFKRLEMARKNKKELNKIKLQLLKEIEQLKLMLRALEEG |
| Ga0212023_10593463 | 3300022061 | Aqueous | MTKYECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0196889_10688381 | 3300022072 | Aqueous | MTKDECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0181353_10529472 | 3300022179 | Freshwater Lake | MTKEELYKRLTMAPKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0181353_10751921 | 3300022179 | Freshwater Lake | GSKMTKDECYKRLEMAQKNKKELKKIKLQLLKEIAQLKLMLRALEEG |
| Ga0181353_10924582 | 3300022179 | Freshwater Lake | MSKDEIYKRLTMAQKNKKELRKIKLQLLKEIEQLKLMLRALEEG |
| Ga0208147_10690912 | 3300025635 | Aqueous | MTKNECMVRLTMAQKNKKELKKIKLQLLKEIQQLKLMLRALEEEEQWVS |
| Ga0208916_105353503 | 3300025896 | Aqueous | MTKYEVYNRLKMAQKNKKELKKVKLDLLKEIQQLKLMLRALEEE |
| Ga0209704_10088192 | 3300027693 | Freshwater Sediment | MTKNEVYKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDGDE |
| Ga0209297_100105828 | 3300027733 | Freshwater Lake | MTKEELYKRLTMAQKNKKELNKIKLQLLKEIEQLKLMLRALEEEDQWAN |
| Ga0209297_100349011 | 3300027733 | Freshwater Lake | MTKDEVYNRLQMAHKNKKELKKVKLDLLKEIQQLKLMLRALEEEEQWAN |
| Ga0209297_100851914 | 3300027733 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKIKLQILKEIEQLKLMLRALEEDDCG |
| Ga0209084_10012903 | 3300027749 | Freshwater Lake | MTKEELYKRLEMAQKNKKDLKKVKLKILAEIQQLKLMLRAMEEQEILDGDE |
| Ga0209084_10041051 | 3300027749 | Freshwater Lake | MTKEELYKRLTMAQKNKKELKKIKLQILKEIEQLKLMLRALEEEEQWAN |
| Ga0209084_10403353 | 3300027749 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKIKLQILKEIEQLKLMLRALEEEEQWVN |
| Ga0209084_10534058 | 3300027749 | Freshwater Lake | MTKYEVYNRLQMAQKNKKELKKVKLDLLKEIQQLKLMLRALEEEEQWAN |
| Ga0209088_102208711 | 3300027763 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKIKLQILKEIEQLKLMLRALEEG |
| Ga0209354_103924832 | 3300027808 | Freshwater Lake | MTKDEVYNRLQMAQKNKKEIKKVKLDLLKEIQQLKLMLRALEEEEQWVN |
| Ga0209253_103685075 | 3300027900 | Freshwater Lake Sediment | MTKQECMSRLQTAQKNKKEIKKVKLDLLKEIQQLKLMLRALEEEEQWVN |
| Ga0209298_1000103015 | 3300027973 | Freshwater Lake | MTKDECFKRLEMAQKNKKELKKVKLDLLKEIQQLKLMLRALEEEEQWAN |
| Ga0209298_100091447 | 3300027973 | Freshwater Lake | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLKLMLRALDEEEQWAS |
| Ga0316616_1029220391 | 3300033521 | Soil | MTKTEVYKRLEMANKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDG |
| Ga0334979_0314631_3_122 | 3300033996 | Freshwater | MTKTEVYKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRA |
| Ga0334979_0355506_310_444 | 3300033996 | Freshwater | MTKDECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEES |
| Ga0334991_0400950_2_130 | 3300034013 | Freshwater | MTKDEVYNRLQMAQKNKKEIKKVKLDLLKEIQQLKLMLRALEE |
| Ga0335005_0128275_1203_1352 | 3300034022 | Freshwater | MTKDEVYNRLQMAQKNKKEIKKVKLDLLKEIQQLKLMLRALEEEEQWAN |
| Ga0335021_0302848_3_173 | 3300034023 | Freshwater | DGTQHPWGDGVKMTKDECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0335021_0502121_227_376 | 3300034023 | Freshwater | MTKNEVCKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDG |
| Ga0335001_0076449_1307_1456 | 3300034064 | Freshwater | MTKQEMFKRLEMAQKNKKELKKVKLKLLAEIQQLKLMLRAMEEQEVLDG |
| Ga0335028_0000514_5856_5990 | 3300034071 | Freshwater | MTKDELYKRLTMAQKNKKELKKIKLQLLKEIEQLKLMLRALEEG |
| Ga0335022_0326281_361_510 | 3300034095 | Freshwater | MTKNEVYKRLEMAQKNKKELKKVKLKILSEIQQLKLMLRAMEEQEVLDG |
| Ga0335025_0033679_2910_3059 | 3300034096 | Freshwater | MTKDECISRLKAAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAH |
| Ga0335025_0321432_709_822 | 3300034096 | Freshwater | MTKDECYKRLEMAQKNKKELKKIKLQLLKEIEQLKLML |
| Ga0335037_0590784_483_587 | 3300034107 | Freshwater | MTKDECISRLKTAQKNKKELRKIKLQLLKEIEQLK |
| Ga0335053_0629104_398_547 | 3300034118 | Freshwater | MTKDEVYNRLQMAQKNKKELKKIKLQILKEIEQLKLMLRALEEEEQWAN |
| Ga0335049_0644139_520_648 | 3300034272 | Freshwater | MTKDEVYNRLQMAQKNKKELKKIKLQILKEIEQLKLMLRALEE |
| Ga0335039_0017746_3663_3812 | 3300034355 | Freshwater | MTKDEMFKRLEMAQKNKKELKKVKLKILAEIQQLKLMLRAMEEQEVLDG |
| Ga0335039_0025183_2232_2381 | 3300034355 | Freshwater | MTKDECISRLKAAQKNKKELRKIKLQLLKEIEQLKLMLRALEEEEQWAN |
| ⦗Top⦘ |