


| Basic Information | |
|---|---|
| Family ID | F100683 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTDHAAAAAEALEKIIAMLRAGHVPEDLGEAVILIGRLMARRT |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.33 % |
| % of genes near scaffold ends (potentially truncated) | 24.51 % |
| % of genes from short scaffolds (< 2000 bps) | 70.59 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (41.176 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.608 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.941 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.922 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00271 | Helicase_C | 29.41 |
| PF13539 | Peptidase_M15_4 | 10.78 |
| PF00182 | Glyco_hydro_19 | 9.80 |
| PF10926 | DUF2800 | 2.94 |
| PF16510 | P22_portal | 1.96 |
| PF01510 | Amidase_2 | 1.96 |
| PF16793 | RepB_primase | 0.98 |
| PF00959 | Phage_lysozyme | 0.98 |
| PF03237 | Terminase_6N | 0.98 |
| PF04404 | ERF | 0.98 |
| PF12728 | HTH_17 | 0.98 |
| PF11134 | Phage_stabilise | 0.98 |
| PF05118 | Asp_Arg_Hydrox | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 9.80 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 9.80 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.82 % |
| Unclassified | root | N/A | 41.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001097|JGIcombinedJ13537_10111446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Yuavirus → Alphaproteobacteria virus phiJl001 | 586 | Open in IMG/M |
| 3300002220|MLSBCLC_10623625 | Not Available | 761 | Open in IMG/M |
| 3300002835|B570J40625_100525030 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300002930|Water_100017 | Not Available | 41566 | Open in IMG/M |
| 3300003393|JGI25909J50240_1033473 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300003394|JGI25907J50239_1083877 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300003395|JGI25917J50250_1026627 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300003404|JGI25920J50251_10043751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1227 | Open in IMG/M |
| 3300003429|JGI25914J50564_10015907 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300003429|JGI25914J50564_10029924 | Not Available | 1584 | Open in IMG/M |
| 3300003429|JGI25914J50564_10067128 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300004481|Ga0069718_16240121 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300005581|Ga0049081_10004014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5534 | Open in IMG/M |
| 3300005582|Ga0049080_10146799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300006803|Ga0075467_10397984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300006805|Ga0075464_10190133 | Not Available | 1217 | Open in IMG/M |
| 3300006863|Ga0075459_1001934 | All Organisms → cellular organisms → Bacteria | 3316 | Open in IMG/M |
| 3300006875|Ga0075473_10218661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300006920|Ga0070748_1361245 | Not Available | 511 | Open in IMG/M |
| 3300007516|Ga0105050_10017721 | Not Available | 6741 | Open in IMG/M |
| 3300007523|Ga0105052_10913912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300007559|Ga0102828_1070886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300007667|Ga0102910_1005963 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300008950|Ga0102891_1019942 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300008995|Ga0102888_1031712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300008996|Ga0102831_1004891 | Not Available | 5073 | Open in IMG/M |
| 3300009037|Ga0105093_10172914 | Not Available | 1096 | Open in IMG/M |
| 3300009081|Ga0105098_10040858 | Not Available | 1859 | Open in IMG/M |
| 3300009081|Ga0105098_10106099 | Not Available | 1218 | Open in IMG/M |
| 3300009085|Ga0105103_10115600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
| 3300009160|Ga0114981_10318291 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300009161|Ga0114966_10588516 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009169|Ga0105097_10107781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1525 | Open in IMG/M |
| 3300010157|Ga0114964_10089459 | Not Available | 1540 | Open in IMG/M |
| 3300010885|Ga0133913_10514907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3151 | Open in IMG/M |
| 3300010885|Ga0133913_10680426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2694 | Open in IMG/M |
| 3300011334|Ga0153697_1061 | Not Available | 34735 | Open in IMG/M |
| 3300012738|Ga0157537_155198 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. SG-bin2 | 781 | Open in IMG/M |
| 3300013065|Ga0157547_115812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 979 | Open in IMG/M |
| 3300016690|Ga0180048_1080266 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. SG-bin2 | 1001 | Open in IMG/M |
| 3300016693|Ga0180038_1065791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → unclassified Shimia → Shimia sp. WX04 | 1807 | Open in IMG/M |
| 3300017716|Ga0181350_1018772 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300017716|Ga0181350_1140053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300017736|Ga0181365_1029736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
| 3300017761|Ga0181356_1065537 | Not Available | 1227 | Open in IMG/M |
| 3300017766|Ga0181343_1140540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300017777|Ga0181357_1108258 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300017777|Ga0181357_1156783 | Not Available | 836 | Open in IMG/M |
| 3300017784|Ga0181348_1008925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4374 | Open in IMG/M |
| 3300018405|Ga0194138_10068307 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300019784|Ga0181359_1068872 | Not Available | 1343 | Open in IMG/M |
| 3300019784|Ga0181359_1075268 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300020160|Ga0211733_10983479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300021959|Ga0222716_10000372 | Not Available | 38276 | Open in IMG/M |
| 3300021961|Ga0222714_10085807 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300022190|Ga0181354_1026956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1860 | Open in IMG/M |
| 3300022213|Ga0224500_10280913 | Not Available | 605 | Open in IMG/M |
| 3300023184|Ga0214919_10363764 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300024343|Ga0244777_10000359 | Not Available | 36260 | Open in IMG/M |
| 3300025896|Ga0208916_10010466 | All Organisms → cellular organisms → Bacteria | 3612 | Open in IMG/M |
| 3300025896|Ga0208916_10479227 | Not Available | 542 | Open in IMG/M |
| 3300027608|Ga0208974_1096301 | Not Available | 794 | Open in IMG/M |
| 3300027659|Ga0208975_1000145 | Not Available | 37065 | Open in IMG/M |
| 3300027659|Ga0208975_1002889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6683 | Open in IMG/M |
| 3300027712|Ga0209499_1151422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300027721|Ga0209492_1075274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
| 3300027734|Ga0209087_1006237 | Not Available | 6340 | Open in IMG/M |
| 3300027749|Ga0209084_1269797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300027754|Ga0209596_1132154 | Not Available | 1132 | Open in IMG/M |
| 3300027754|Ga0209596_1399554 | Not Available | 516 | Open in IMG/M |
| 3300027759|Ga0209296_1026674 | All Organisms → cellular organisms → Bacteria | 3225 | Open in IMG/M |
| 3300027770|Ga0209086_10000801 | Not Available | 26081 | Open in IMG/M |
| 3300027782|Ga0209500_10043216 | Not Available | 2455 | Open in IMG/M |
| 3300027797|Ga0209107_10355192 | Not Available | 677 | Open in IMG/M |
| 3300027798|Ga0209353_10059219 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300027808|Ga0209354_10202778 | Not Available | 804 | Open in IMG/M |
| 3300027848|Ga0209390_10446878 | Not Available | 898 | Open in IMG/M |
| 3300027976|Ga0209702_10015311 | All Organisms → cellular organisms → Bacteria | 7115 | Open in IMG/M |
| 3300028066|Ga0255200_1012702 | Not Available | 1452 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10494187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300031578|Ga0307376_10123690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1807 | Open in IMG/M |
| 3300031787|Ga0315900_10930223 | Not Available | 580 | Open in IMG/M |
| 3300031951|Ga0315904_11119609 | Not Available | 612 | Open in IMG/M |
| 3300031952|Ga0315294_10061545 | All Organisms → cellular organisms → Bacteria | 3969 | Open in IMG/M |
| 3300031952|Ga0315294_10212198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1916 | Open in IMG/M |
| 3300031999|Ga0315274_11331162 | Not Available | 698 | Open in IMG/M |
| 3300032018|Ga0315272_10746703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300032092|Ga0315905_10003064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17357 | Open in IMG/M |
| 3300032092|Ga0315905_10261443 | Not Available | 1676 | Open in IMG/M |
| 3300032143|Ga0315292_11377470 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300033816|Ga0334980_0266218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300033992|Ga0334992_0132881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1297 | Open in IMG/M |
| 3300033993|Ga0334994_0132778 | Not Available | 1421 | Open in IMG/M |
| 3300033996|Ga0334979_0195041 | Not Available | 1198 | Open in IMG/M |
| 3300033996|Ga0334979_0750050 | Not Available | 506 | Open in IMG/M |
| 3300034022|Ga0335005_0051750 | Not Available | 2764 | Open in IMG/M |
| 3300034062|Ga0334995_0126699 | Not Available | 1882 | Open in IMG/M |
| 3300034073|Ga0310130_0019818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2160 | Open in IMG/M |
| 3300034101|Ga0335027_0499693 | Not Available | 763 | Open in IMG/M |
| 3300034104|Ga0335031_0035359 | Not Available | 3634 | Open in IMG/M |
| 3300034119|Ga0335054_0000143 | Not Available | 37016 | Open in IMG/M |
| 3300034356|Ga0335048_0073838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2118 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.88% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 3.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.98% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.98% |
| Watersheds | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.98% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.98% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.98% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.98% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.98% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001097 | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300012738 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES023 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013065 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES037 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016690 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES019 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016693 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES036 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300018405 | Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T2_14 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027848 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028066 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13537_101114462 | 3300001097 | Hypersaline | MTDHAAATVEALEKVIALLKAGQSPEDLGEAVILLGRMMARRT* |
| MLSBCLC_106236252 | 3300002220 | Hydrocarbon Resource Environments | MTDHAEAAAILLQAIIDKLKAGETPEDLGREVTLIGRMMERKT* |
| B570J40625_1005250304 | 3300002835 | Freshwater | MTDHAAAAAEALEKIIAMLRAGHAPEDLGEAVILLGRLMARRT* |
| Water_10001718 | 3300002930 | Estuary Water | MTDHAEAAALMLEKVADLLRAGRPPEDLGQYVVWIGRMMARKT* |
| JGI25909J50240_10334733 | 3300003393 | Freshwater Lake | MTDHAAAAAEALEKVLAMLRAGHAPEDLGEAVILLGRLMARRT* |
| JGI25907J50239_10838772 | 3300003394 | Freshwater Lake | MTDHAAAAAEALEKVLALLRAGHVPEDLGEAVILIGRLMARRT* |
| JGI25917J50250_10266271 | 3300003395 | Freshwater Lake | MTDHSAAAVEALEKIIAMLRAGHSPEDLGEAVILLGRLMARRT* |
| JGI25920J50251_100437512 | 3300003404 | Freshwater Lake | MTDHAAAAAEALEKVLAMLRAGHAPEDLGEAVILIGRLMARRT* |
| JGI25914J50564_100159072 | 3300003429 | Freshwater Lake | MTDHAAAAAEALEKVLAMLRAGHVPEDLGEAVILIGRLMARRT* |
| JGI25914J50564_100299243 | 3300003429 | Freshwater Lake | YEEMTDHAAAAAEALEKVLAMLRAGHAPEDLGEAVILIGRLMARRT* |
| JGI25914J50564_100671281 | 3300003429 | Freshwater Lake | MTDHSAAAVEALEKIIAMLRAGHSPEDLGEAVILLGRLMA |
| Ga0069718_162401212 | 3300004481 | Sediment | MTDHAAATAEALEMVIAMLKAGQSPEDLGPMVILIGRMMARRT* |
| Ga0049081_100040142 | 3300005581 | Freshwater Lentic | MTDHAAAAAEALEKIIAMLRAGHVPEDLGEAVILIGRLMARRT* |
| Ga0049080_101467994 | 3300005582 | Freshwater Lentic | MTDHAAATAEALEKIIALLRAGHSPEDLGEAVILIGRMMARRT* |
| Ga0075467_103979843 | 3300006803 | Aqueous | MTDHAAAAAEALEKILALLRAGHAPEDLGEAVILLGRLMARRT* |
| Ga0075464_101901332 | 3300006805 | Aqueous | MTDHAAAAAEALEKVIAMLKAGQSPEDLGPMVILIGRMMARRT* |
| Ga0075459_10019344 | 3300006863 | Aqueous | MTDHAAATAEALEKVIAMLKAGQSPEDLGPMVILIGRMMARRT* |
| Ga0075473_102186614 | 3300006875 | Aqueous | VTDHAAAAAEALEKIVALLRAGQPPEDLGPMVILVGRLMARRT* |
| Ga0070748_13612452 | 3300006920 | Aqueous | MTDHAAATAEALEMVIAMLKAGQSPEDLGPTVILIGRMMARRT* |
| Ga0105050_100177216 | 3300007516 | Freshwater | MTDHAAATAEALEKIITLLRAGESPEDLGTTVILIGRMMARRT* |
| Ga0105052_109139123 | 3300007523 | Freshwater | MTDHAAATAEALEKIITLLRAGESPEDLGTTVILIGRMM |
| Ga0102828_10708863 | 3300007559 | Estuarine | MTDHAAATAEALEKVIAMLRAGQSPEDLGPIVILIGRMMARRT* |
| Ga0102910_10059636 | 3300007667 | Estuarine | MTDHAAATVEALEELIALLRAGYSPEDLGDAVILLG |
| Ga0102891_10199425 | 3300008950 | Estuarine | MTDHAAATVEALEELIALLRAGYSPEDLGDAVILLGRLMARRT* |
| Ga0102888_10317124 | 3300008995 | Estuarine | MTDHAAATVEALEELIALLRAGYSPEDLGDAVILLGRLMAR |
| Ga0102831_10048917 | 3300008996 | Estuarine | MTDHAEAAAEALEAIVAMLKAGYPPEDLGKDVILVGRLMARRT* |
| Ga0105093_101729143 | 3300009037 | Freshwater Sediment | MTDHAAATVEALEKVIAMLKAGQSPEDLGPMVILIGRMMARRT* |
| Ga0105098_100408582 | 3300009081 | Freshwater Sediment | MTDHAAASAEALEMVIAMLRAGRPPEDLGPIVILIGRMMARRT* |
| Ga0105098_101060991 | 3300009081 | Freshwater Sediment | MTDHAAATAEALEMVIAMLRAGQSPEDLGPMVILIGRMMAR |
| Ga0105103_101156004 | 3300009085 | Freshwater Sediment | MTDHAEAAAEALEKMTALLRAGQSPEDLGPMVILIGRMMARRT* |
| Ga0114981_103182911 | 3300009160 | Freshwater Lake | MTDHAAATVEALEKIIALLRAGHAPEDLGEAVILLGRLMARRT* |
| Ga0114966_105885163 | 3300009161 | Freshwater Lake | MTDHAAATVEALEKIIALLRAGHVPEDLGEAVILLGRLMARRT* |
| Ga0105097_101077815 | 3300009169 | Freshwater Sediment | VEEMTDHAAATAEALEMVIAMLKAGQSPEDLGPMVILIGRMMARRT* |
| Ga0114964_100894593 | 3300010157 | Freshwater Lake | MTDHAEAAALMLEKVADLLRAGRPPEDLGELVVLIGRMMARRT* |
| Ga0133913_105149074 | 3300010885 | Freshwater Lake | VTDHAEAAALMLEKVADLLRAGRPPEDLGQYVVWIGRMMARKT* |
| Ga0133913_106804267 | 3300010885 | Freshwater Lake | VTDHAEAAALMLEKVADLLRAGRPPEDLGELVVLIGRMMARRT* |
| Ga0153697_106147 | 3300011334 | Freshwater | MTDHAAATAEALEKVIAMLKAGQSPEDLGSMVILIGRMMARRT* |
| Ga0157537_1551983 | 3300012738 | Freshwater | RDRAMTDHAEAAALMLEKVADLLRAGRSPEDLGQYVVWIGRMMARKT* |
| Ga0157547_1158121 | 3300013065 | Freshwater | LMLEKVADLLRAGRSPEDLGQYVVWIGRMMARKT* |
| Ga0180048_10802663 | 3300016690 | Freshwater | MTDHAEAAALMLEKVADLLRAGRSPEDLGQYVVWIGRMMARKT |
| Ga0180038_10657916 | 3300016693 | Freshwater | DHAEAAALMLEKVADLLRAGRSPEDLGQYVVWIGRMMARKT |
| Ga0181350_10187723 | 3300017716 | Freshwater Lake | VDKQMTDHADAAAAALEKVIAMLLAGHPPEDLGEAVILIGRMMARRT |
| Ga0181350_11400532 | 3300017716 | Freshwater Lake | MTDHAAAAAEALEKIIAMLRAGHVPENLGEAVILIGRLMARRT |
| Ga0181365_10297363 | 3300017736 | Freshwater Lake | MTDHAEATAEALERIIALLRANVPPEDLGRQVQIIGRMMERRT |
| Ga0181356_10655372 | 3300017761 | Freshwater Lake | AAAAAEALEKVLALLRAGHVPEDLGEAVILIGRLMARRT |
| Ga0181343_11405401 | 3300017766 | Freshwater Lake | MTDHAEATVEALEKIIALLRAGHSPEDLGEAVILIGRMMARRT |
| Ga0181357_11082582 | 3300017777 | Freshwater Lake | MTDHAEATAEALERVIALLRANVPPEDLGRQVQIIGRMMERRT |
| Ga0181357_11567832 | 3300017777 | Freshwater Lake | MTDHADAAAAALEKVIAMLLAGHPPEDLGEAVILIGRMMARRT |
| Ga0181348_10089253 | 3300017784 | Freshwater Lake | MTDHAAAAVEAMEKIIAMLRAGHSPEDLGEAVILIGRLMARRT |
| Ga0194138_100683071 | 3300018405 | Watersheds | MTDHAAATVEALEKILALLRAGHAPEDLGEAVILLGRLMARRT |
| Ga0181359_10688722 | 3300019784 | Freshwater Lake | MTDHSAAAVEALEKIIAMLRAGHSPEDLGEAVILLGRLMARRT |
| Ga0181359_10752682 | 3300019784 | Freshwater Lake | MTDHAAAAAEALEKIIALLRAGHAPEDLGEAVILIGRLMARRT |
| Ga0211733_109834792 | 3300020160 | Freshwater | MTDHAEAAAEALEKVIAMLRAGHAPEDLGEAVILIGRMMARRT |
| Ga0222716_1000037236 | 3300021959 | Estuarine Water | MTDHAEAAVEMLEQIIEGLRAGYSPEDLGPLVVLIGRLMARRT |
| Ga0222714_100858072 | 3300021961 | Estuarine Water | MTDHAAATVEALEKVLALLRAGHSPEDLGETVILLGRLMARRT |
| Ga0181354_10269562 | 3300022190 | Freshwater Lake | MTDHAAAAAEALEKVLAMLRAGHAPEDLGEAVILIGRLMARRT |
| Ga0224500_102809132 | 3300022213 | Sediment | MIDHAEAAVEMLEQIIEGLRAGYSPEDLGPLVVLIGRLMARRT |
| Ga0214919_103637642 | 3300023184 | Freshwater | MTDHAEAAAVMLEKVAALLRAGHAPEDLGEAVILLGRLMARRT |
| Ga0244777_1000035923 | 3300024343 | Estuarine | MTDHAAATVEALEELIALLRAGYSPEDLGDAVILLGRLMARRT |
| Ga0208916_100104661 | 3300025896 | Aqueous | MTDHAAAAAEALEKVLALLRAGHVPEDLGEAVILI |
| Ga0208916_104792272 | 3300025896 | Aqueous | MTDHAAAAAEALEKVIAMLKAGQSPEDLGPMVILIGRMMARRT |
| Ga0208974_10963012 | 3300027608 | Freshwater Lentic | DHAAAAAEALEKVLALLRAGHVPEDLGEAVILIGRLMARRT |
| Ga0208975_100014536 | 3300027659 | Freshwater Lentic | MTDHAAAAAEALEKVLALLRAGHVPEDLGEAVILIGRLMARRT |
| Ga0208975_10028893 | 3300027659 | Freshwater Lentic | MTDHAAAAAEALEKIIAMLRAGHAPEDLGEAVIILGRLMARRT |
| Ga0209499_11514221 | 3300027712 | Freshwater Lake | VTDHAEAAALMLEKVADLLRAGRPPEDLGELVVLIGRMMARRT |
| Ga0209492_10752743 | 3300027721 | Freshwater Sediment | MTDHAEAAAEALEKMTALLRAGQSPEDLGPMVILIGRMMARRT |
| Ga0209087_10062373 | 3300027734 | Freshwater Lake | MTDHAEAAALMLEKVADLLRAGRPPEDLGELVVLIGRMMARRT |
| Ga0209084_12697973 | 3300027749 | Freshwater Lake | VTDHAEAAALMLEKVADLLRAGRPPEDLGELVVLIGR |
| Ga0209596_11321541 | 3300027754 | Freshwater Lake | TDHAAAAAEALEKVLAMLRAGHVPEDLGEAVILIGRLMARRT |
| Ga0209596_13995543 | 3300027754 | Freshwater Lake | MTDHAAATVEALEKIIALLRAGHAPEDLGEAVILLGRLMARRT |
| Ga0209296_10266741 | 3300027759 | Freshwater Lake | MTDHAAATVEALEKIIALLRAGHVPEDLGEAVILLGRLMARRT |
| Ga0209086_100008013 | 3300027770 | Freshwater Lake | MTDHAAAAAEALEKVLAMLRAGHVPEDLGEAVILIGRLMARRT |
| Ga0209500_100432163 | 3300027782 | Freshwater Lake | MTDHAAAAAEALEKIIAMLRAGHVPEDLGDDVILIGRLMARRT |
| Ga0209107_103551922 | 3300027797 | Freshwater And Sediment | MTDHAAAAAEALENIIAMLRAGHAPEDLGEAVIILGRLMARRT |
| Ga0209353_100592192 | 3300027798 | Freshwater Lake | MTDHADAAAEALEKVLAMLRAGHAPEDLGEAVILIGRLMARRT |
| Ga0209354_102027782 | 3300027808 | Freshwater Lake | AAAVEAMEKIIAMLRAGHSPEDLGEAVILIGRLMARRT |
| Ga0209390_104468782 | 3300027848 | Freshwater | MTDHAAATVEALEKVIALLKAGQSPEDLGEAVILLGRMMARRT |
| Ga0209702_100153117 | 3300027976 | Freshwater | MTDHAAATAEALEKIITLLRAGESPEDLGTTVILIGRMMARRT |
| Ga0255200_10127024 | 3300028066 | Freshwater | EMTDHAAATAEALEMVIAMLKAGQSPEDLGPMVILIGRMMARRT |
| (restricted) Ga0247840_104941873 | 3300028581 | Freshwater | MTDHAAAAVEAMEKIIAMLRAGVSPEDLGEAVILLGRLMARRT |
| Ga0307376_101236903 | 3300031578 | Soil | MTDHAAAAAEALEKVVAMLRAGVSPEDLGEAVILIGRLMARRT |
| Ga0315900_109302232 | 3300031787 | Freshwater | MTDHAEAAAEALEKITALLRAGGSPEDLGPWVILLGRMMARKT |
| Ga0315904_111196093 | 3300031951 | Freshwater | HAEAAALALEKMAALLRAGRPPEELGADVVLIGRMMARRT |
| Ga0315294_100615451 | 3300031952 | Sediment | MTDHAAAAVEALEKIIAMLRAGHVPENLGEAVILI |
| Ga0315294_102121985 | 3300031952 | Sediment | MTDHAAAAVEALEKIIAMLRAGHVPENLGEAVILIGRLMARRT |
| Ga0315274_113311623 | 3300031999 | Sediment | MTDHAAAAAEALEKILALLRAGHAPEDLGEGVILLGRLMARRT |
| Ga0315272_107467031 | 3300032018 | Sediment | EEMTDHAAAAVEALEKIIAMLRAGHVPENLGEAVILIGRLMARRT |
| Ga0315905_1000306418 | 3300032092 | Freshwater | MTDHAAAAAEALEKILALLRAGHSPEDLGEAVVLLGRLMARRT |
| Ga0315905_102614433 | 3300032092 | Freshwater | MTDHAEAAAEALEAIVDLLKAGYPPEDLGEDVILVGRLMARRT |
| Ga0315292_113774701 | 3300032143 | Sediment | MTDHAAATVEALEKIIAMLRAGHVPENLGEAVILIGRLMARRT |
| Ga0334980_0266218_559_672 | 3300033816 | Freshwater | MTDHAAATAEALEMVIAMLKAGQSPEDLGPMVILIGRM |
| Ga0334992_0132881_290_421 | 3300033992 | Freshwater | VTDHAEAAALLLEAVAAKLRAGFPPEDLGREVALIGRMMERKT |
| Ga0334994_0132778_788_919 | 3300033993 | Freshwater | MTDHAAAAAEALEKIIAMLRAGHAPEDLGEAVILLGRLMARRT |
| Ga0334979_0195041_211_342 | 3300033996 | Freshwater | MTDHAAATAEALEMVIAMLRAGQSPEDLGPIVILIGRMMARRT |
| Ga0334979_0750050_359_505 | 3300033996 | Freshwater | DEVEEMTDHAAATAEALEMVIAMLKAGQSPEDLGPMVILIGRMMARRT |
| Ga0335005_0051750_335_466 | 3300034022 | Freshwater | MTDHAAAAAEALEKIIAMLRAGYAPEDLGEAVILLGRLMARRT |
| Ga0334995_0126699_1_117 | 3300034062 | Freshwater | AAAAEALEKVIAMLKAGQSPEDLGPMVILIGRMMARRT |
| Ga0310130_0019818_2005_2136 | 3300034073 | Fracking Water | MTDHAEAAAIMLEKMAALLRAGRPPEDLGEMVVLIGRMMARKT |
| Ga0335027_0499693_1_126 | 3300034101 | Freshwater | DHAAATAEALEKVIAMLKAGQSPEDLGPMVILIGRMMARRT |
| Ga0335031_0035359_2368_2499 | 3300034104 | Freshwater | MTDHAAATAEALEKVIAMLKAGQSPEDLGPIVILIGRMMARRT |
| Ga0335054_0000143_18996_19127 | 3300034119 | Freshwater | MTDHAAAAAEALDKIIAMLRAGHVPEDLGEAVILIGRLMARRT |
| Ga0335048_0073838_652_783 | 3300034356 | Freshwater | VTDHAEAAALLLEAVVAKLRAGFPPEDLGREVALIGRMMERKT |
| ⦗Top⦘ |