


| Basic Information | |
|---|---|
| Family ID | F100645 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 53 residues |
| Representative Sequence | GRGAYRTPVNTAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVVLPRL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.549 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.823 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.235 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.020 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.33% β-sheet: 5.33% Coil/Unstructured: 85.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01161 | PBP | 7.84 |
| PF00463 | ICL | 6.86 |
| PF03965 | Penicillinase_R | 3.92 |
| PF00133 | tRNA-synt_1 | 2.94 |
| PF12483 | GIDE | 2.94 |
| PF05685 | Uma2 | 2.94 |
| PF00939 | Na_sulph_symp | 1.96 |
| PF05569 | Peptidase_M56 | 1.96 |
| PF05626 | DUF790 | 1.96 |
| PF04545 | Sigma70_r4 | 1.96 |
| PF07228 | SpoIIE | 0.98 |
| PF00732 | GMC_oxred_N | 0.98 |
| PF13646 | HEAT_2 | 0.98 |
| PF00892 | EamA | 0.98 |
| PF00535 | Glycos_transf_2 | 0.98 |
| PF07992 | Pyr_redox_2 | 0.98 |
| PF04191 | PEMT | 0.98 |
| PF13515 | FUSC_2 | 0.98 |
| PF03227 | GILT | 0.98 |
| PF01680 | SOR_SNZ | 0.98 |
| PF03631 | Virul_fac_BrkB | 0.98 |
| PF00069 | Pkinase | 0.98 |
| PF00753 | Lactamase_B | 0.98 |
| PF09594 | GT87 | 0.98 |
| PF12697 | Abhydrolase_6 | 0.98 |
| PF01568 | Molydop_binding | 0.98 |
| PF00009 | GTP_EFTU | 0.98 |
| PF00171 | Aldedh | 0.98 |
| PF07586 | HXXSHH | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 7.84 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 6.86 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.92 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 3.92 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 3.92 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.94 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.94 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.94 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.94 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 2.94 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 1.96 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 1.96 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.98 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.98 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.98 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.98 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.98 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.55 % |
| Unclassified | root | N/A | 27.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y02IM69T | Not Available | 581 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1944848 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300000956|JGI10216J12902_111281617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 674 | Open in IMG/M |
| 3300004081|Ga0063454_101191597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300004114|Ga0062593_102860689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300005093|Ga0062594_102218566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 594 | Open in IMG/M |
| 3300005260|Ga0074072_1050555 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005327|Ga0070658_11690599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Luteipulveratus → Luteipulveratus mongoliensis | 548 | Open in IMG/M |
| 3300005332|Ga0066388_100646794 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300005337|Ga0070682_100545700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 906 | Open in IMG/M |
| 3300005337|Ga0070682_102040753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 505 | Open in IMG/M |
| 3300005343|Ga0070687_101226907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300005355|Ga0070671_101846220 | Not Available | 537 | Open in IMG/M |
| 3300005365|Ga0070688_100609719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 836 | Open in IMG/M |
| 3300005439|Ga0070711_100706385 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005459|Ga0068867_102033340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 543 | Open in IMG/M |
| 3300005534|Ga0070735_10471974 | Not Available | 748 | Open in IMG/M |
| 3300005535|Ga0070684_100572090 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005546|Ga0070696_101247037 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005563|Ga0068855_101316246 | Not Available | 747 | Open in IMG/M |
| 3300005616|Ga0068852_101027297 | Not Available | 843 | Open in IMG/M |
| 3300005616|Ga0068852_101797532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 635 | Open in IMG/M |
| 3300005618|Ga0068864_100320219 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300005718|Ga0068866_10455541 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005843|Ga0068860_101709148 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005844|Ga0068862_102793026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300006806|Ga0079220_10920826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300006871|Ga0075434_100933365 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300009156|Ga0111538_14002310 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009177|Ga0105248_12848505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 551 | Open in IMG/M |
| 3300009545|Ga0105237_10465138 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300010360|Ga0126372_12536287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 564 | Open in IMG/M |
| 3300010362|Ga0126377_13273583 | Not Available | 524 | Open in IMG/M |
| 3300010397|Ga0134124_11016049 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300010400|Ga0134122_12445025 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010877|Ga0126356_11424579 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300011435|Ga0137426_1189169 | Not Available | 613 | Open in IMG/M |
| 3300012212|Ga0150985_103808955 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 528 | Open in IMG/M |
| 3300012469|Ga0150984_101130809 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012532|Ga0137373_10207612 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1609 | Open in IMG/M |
| 3300012929|Ga0137404_12185413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 517 | Open in IMG/M |
| 3300013296|Ga0157374_10568334 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300013296|Ga0157374_11921036 | Not Available | 618 | Open in IMG/M |
| 3300013296|Ga0157374_12544404 | Not Available | 539 | Open in IMG/M |
| 3300013297|Ga0157378_10993844 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300014325|Ga0163163_10073572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3408 | Open in IMG/M |
| 3300014968|Ga0157379_11686021 | Not Available | 621 | Open in IMG/M |
| 3300015371|Ga0132258_13431024 | Not Available | 1087 | Open in IMG/M |
| 3300015372|Ga0132256_102918974 | Not Available | 575 | Open in IMG/M |
| 3300015374|Ga0132255_100784527 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300016294|Ga0182041_12340849 | Not Available | 500 | Open in IMG/M |
| 3300017937|Ga0187809_10336356 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300018083|Ga0184628_10033779 | Not Available | 2555 | Open in IMG/M |
| 3300021358|Ga0213873_10255922 | Not Available | 556 | Open in IMG/M |
| 3300021384|Ga0213876_10594686 | Not Available | 589 | Open in IMG/M |
| 3300021404|Ga0210389_10316070 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300021405|Ga0210387_10062872 | All Organisms → cellular organisms → Bacteria | 3017 | Open in IMG/M |
| 3300024288|Ga0179589_10475069 | Not Available | 578 | Open in IMG/M |
| 3300025899|Ga0207642_10497223 | Not Available | 746 | Open in IMG/M |
| 3300025909|Ga0207705_11211169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Luteipulveratus → Luteipulveratus mongoliensis | 579 | Open in IMG/M |
| 3300025916|Ga0207663_10213278 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300025917|Ga0207660_11204665 | Not Available | 616 | Open in IMG/M |
| 3300025924|Ga0207694_11795121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300025926|Ga0207659_11344093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 613 | Open in IMG/M |
| 3300025931|Ga0207644_11424426 | Not Available | 582 | Open in IMG/M |
| 3300025941|Ga0207711_11653348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 584 | Open in IMG/M |
| 3300025960|Ga0207651_10626406 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300025986|Ga0207658_10236418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1545 | Open in IMG/M |
| 3300026078|Ga0207702_11769927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 610 | Open in IMG/M |
| 3300026089|Ga0207648_11528761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 627 | Open in IMG/M |
| 3300026095|Ga0207676_10300983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1464 | Open in IMG/M |
| 3300028380|Ga0268265_11805362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 618 | Open in IMG/M |
| 3300028381|Ga0268264_12314128 | Not Available | 544 | Open in IMG/M |
| 3300028802|Ga0307503_10385542 | Not Available | 728 | Open in IMG/M |
| 3300028861|Ga0302259_1000292 | All Organisms → cellular organisms → Bacteria | 9853 | Open in IMG/M |
| 3300028870|Ga0302254_10050150 | Not Available | 1503 | Open in IMG/M |
| 3300029923|Ga0311347_10812929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300029980|Ga0302298_10285994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300029984|Ga0311332_10123820 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300029984|Ga0311332_11759469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → unclassified Kofleriaceae → Kofleriaceae bacterium | 504 | Open in IMG/M |
| 3300030010|Ga0302299_10185920 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300030294|Ga0311349_10176412 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300031200|Ga0307496_10009810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1213 | Open in IMG/M |
| 3300031238|Ga0265332_10222143 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031250|Ga0265331_10146469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1073 | Open in IMG/M |
| 3300031507|Ga0307509_10815464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 598 | Open in IMG/M |
| 3300031616|Ga0307508_10324548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1131 | Open in IMG/M |
| 3300031679|Ga0318561_10578469 | Not Available | 618 | Open in IMG/M |
| 3300031712|Ga0265342_10554706 | Not Available | 582 | Open in IMG/M |
| 3300031715|Ga0307476_10081992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2253 | Open in IMG/M |
| 3300031723|Ga0318493_10061114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1812 | Open in IMG/M |
| 3300031724|Ga0318500_10719703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 509 | Open in IMG/M |
| 3300031771|Ga0318546_11202800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300031805|Ga0318497_10291252 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300031947|Ga0310909_11241634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 601 | Open in IMG/M |
| 3300032035|Ga0310911_10402492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 792 | Open in IMG/M |
| 3300032074|Ga0308173_10986294 | Not Available | 782 | Open in IMG/M |
| 3300032074|Ga0308173_11071011 | Not Available | 751 | Open in IMG/M |
| 3300032074|Ga0308173_11604147 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300032076|Ga0306924_11743881 | Not Available | 651 | Open in IMG/M |
| 3300032180|Ga0307471_100979244 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300034191|Ga0373909_0215340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.98% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.98% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.98% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034191 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_03301690 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | NIDDEYWATSRRPAAESHHGYYRTPTNRAGIDLSDAVYASLGLHDNDVVEWRFVHRGYLVLPWL |
| ICChiseqgaiiDRAFT_19448481 | 3300000033 | Soil | PAAERGRGAYRTPVNRAGIDLSDATFALLGLRDNDWVEWRFVHQGYLIMPWL* |
| JGI10216J12902_1112816172 | 3300000956 | Soil | AERGRGTFRKPANPAGIDLSDATFAQLGLADNDYVEWRFVHRGYVPLPRLGTP* |
| Ga0063454_1011915972 | 3300004081 | Soil | VDDAYWSNGQRPAAERGRGSYRSPVNRAGIDLSDATFATLGLRDNDMVEWRFVHRGYVPFPRLAAAR* |
| Ga0062593_1028606892 | 3300004114 | Soil | DDYWSNGQRPAAERGRGTYRTPVNRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPLPRLAASSPRD* |
| Ga0062594_1022185661 | 3300005093 | Soil | TSDDYWSSGQRPAAEHGRGAYRTPVNSAGIDLSDATFALLGLRDNDWVEWRFVHRGYVPLPRVAIGRH* |
| Ga0074072_10505551 | 3300005260 | Soil | ASERGHGAYRTPVNRAGIDLSDPVFAELGMRDNDEVDWRFVHRDFTILPRL* |
| Ga0070658_116905992 | 3300005327 | Corn Rhizosphere | VNPAGIDLSDPVFAELGLRDNDTVEWRFVHRDFTLLPSL* |
| Ga0066388_1006467943 | 3300005332 | Tropical Forest Soil | YRTPVNTAGIDLSDAVFAALGLPDNDLVDWRFVHRGYVTWPRL* |
| Ga0070682_1005457001 | 3300005337 | Corn Rhizosphere | TYRTPVNRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPLPRLASGH* |
| Ga0070682_1020407531 | 3300005337 | Corn Rhizosphere | AERGRGSYRTPANRAGIDLSDATFATLGLRDNDYVEWRFVHRGYIPFPRLAATGRW* |
| Ga0070687_1012269072 | 3300005343 | Switchgrass Rhizosphere | IDDAYWETGQRPAAERGRGAYRTPVNRAGIDLSDGVFFALGLRDNDYPEWRFVHRGYVALPRL* |
| Ga0070671_1018462202 | 3300005355 | Switchgrass Rhizosphere | GRGAYRTPANRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRMGTSTSTQSRR* |
| Ga0070688_1006097191 | 3300005365 | Switchgrass Rhizosphere | PAAERGRGTFRTPANRAGIDLSDATFALLGLRDNDWVEWRFVHRGYVPLPRVAIGRH* |
| Ga0070711_1007063853 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DDPYWEHDARPASERGRGAYRTPVNHAGIDLSDPVFAELGLRDNDQVEWRFVHRDFTILPRL* |
| Ga0068867_1020333402 | 3300005459 | Miscanthus Rhizosphere | RGRGAYRTPANRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRLAGRAILDR* |
| Ga0070735_104719742 | 3300005534 | Surface Soil | RTPVNTAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVVLPRL* |
| Ga0070684_1005720901 | 3300005535 | Corn Rhizosphere | AYRTPVNRAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVVLPRL* |
| Ga0070696_1012470372 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DAYWVGSRRPAAERAVGKYRTPSNRAGIDLSNAVFAALGLHDNDWVEWRFVHQGYLILPTL* |
| Ga0068855_1013162462 | 3300005563 | Corn Rhizosphere | GAYRTPVNRAGIDLSDPVFAELGMRDNDEVEWRFVHRDFTILPRL* |
| Ga0068852_1010272971 | 3300005616 | Corn Rhizosphere | ASERGHGAYRTPVNRAGIDLSDPVFAELGMRDNDEVEWRFVHRDFTILPRL* |
| Ga0068852_1017975321 | 3300005616 | Corn Rhizosphere | TPANRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRLAGRAILDR* |
| Ga0068864_1003202193 | 3300005618 | Switchgrass Rhizosphere | YWEHDARPASERGRGAYRTPVNHAGIDLSDPVFAELGLRDNDQVEWRFVHRDFTILPRL* |
| Ga0068866_104555411 | 3300005718 | Miscanthus Rhizosphere | RGRGAYRTPVNKAGIDLSDAVFAELGLADNDYVDWRFVHRDYVALPFL* |
| Ga0068860_1017091483 | 3300005843 | Switchgrass Rhizosphere | YWERDARPASERGRGAYRTPVNMAGIDLSDAVFAALGLPDNDFVDWRFVHRGYVVLPWL* |
| Ga0068862_1027930261 | 3300005844 | Switchgrass Rhizosphere | PWNVDDAYWERDARPASERGRGAYRTPVNTAGIDLSDAVFAELGLPDNDVVEWRFVRRGYTVLPRL* |
| Ga0079220_109208262 | 3300006806 | Agricultural Soil | YWDHDARPASERGRGAYRTPVNPAGIDLSDAVFAELGLSNNDYVDWRFVHRDYVAWPVL* |
| Ga0075434_1009333651 | 3300006871 | Populus Rhizosphere | RGRGTYRTPVNRAGIDLSDATFATLGLHDNDWVEWRFVHRGYIPLPRVAAGGPGDR* |
| Ga0111538_140023102 | 3300009156 | Populus Rhizosphere | GTFRKPANPAGIDLSDATFASLGLRDNDYVEWRFVHRGYIPLPRLSLTPPR* |
| Ga0105248_128485052 | 3300009177 | Switchgrass Rhizosphere | YRTPVNSAGIDLSDATFALLGLRDNDWVEWRFVHRGYVPLPRVAIGRH* |
| Ga0105237_104651383 | 3300009545 | Corn Rhizosphere | WEHDARPASERGHGAYRTPVNRAGIDLSDPVFAELGMRDNDEVEWRFVHRDFTILPRL* |
| Ga0126372_125362871 | 3300010360 | Tropical Forest Soil | GIDLSDAVFAALGLPDNDRVDWRFVHRGYVIWPRL* |
| Ga0126377_132735832 | 3300010362 | Tropical Forest Soil | WETSRRPAAELGVGAYRKPVNPAGIDLSDATFAALQLADNDYLEWRFVHRGYVPLPRLSSP* |
| Ga0134124_110160493 | 3300010397 | Terrestrial Soil | PAAERGRGAFRKPANPAGIDLSDAVYATLGLKDNDYLEWRFVHRGYVPLPRL* |
| Ga0134122_124450251 | 3300010400 | Terrestrial Soil | WERDERPASERGRGYYRTPVNTAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVIWPRL* |
| Ga0126356_114245793 | 3300010877 | Boreal Forest Soil | GPWNVDDAYWETDDRPASERSIGTYRTPVNIAGIDLSDAVFAALGLRDNDYVDWRFVHRDYVVLPKL* |
| Ga0137426_11891691 | 3300011435 | Soil | ERGRGTFRTPANRAGIDLSDATFALLGLRDNDWGEWRFVHRGYVALPRVGVGPSP* |
| Ga0150985_1038089552 | 3300012212 | Avena Fatua Rhizosphere | GYYRTPVNTAGIDLSDAVFAALGLPDNDVVEWRFVHRGYVVLPRL* |
| Ga0150984_1011308091 | 3300012469 | Avena Fatua Rhizosphere | YRKPSNTAGIDLSDPVFAALGLRDNDYVDWRFLHRDYVVLPHL* |
| Ga0137373_102076121 | 3300012532 | Vadose Zone Soil | RRPAAERSRGAYRTPSNRAGIDLSDPVFAALGLRDNDWVEWRFVHKGYLVLPWL* |
| Ga0137404_121854132 | 3300012929 | Vadose Zone Soil | VNIAGIDLSDAVFAALGLPDNDVVEWRFVHRGYVVLPRL* |
| Ga0157374_105683343 | 3300013296 | Miscanthus Rhizosphere | GRGAYRTPVNHAGIDLSDPVFAELGLRDNDQVEWRFVHRDFTILPRL* |
| Ga0157374_119210361 | 3300013296 | Miscanthus Rhizosphere | NRAGIDLSDAVFHQLGLRDNDWVEWRFVHKGYLALPAL* |
| Ga0157374_125444042 | 3300013296 | Miscanthus Rhizosphere | QRPAAERGRGAYRTPANRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRMATSTSTQSGR* |
| Ga0157378_109938441 | 3300013297 | Miscanthus Rhizosphere | ARPASERGRGAYRTPVNHAGIDLSDPVFAELGLRDNDQVEWRFVHRDFTILPRL* |
| Ga0163163_100735724 | 3300014325 | Switchgrass Rhizosphere | AAESHHGYYRTPTNRAGIDLSDAVYASLGLHDNDVVEWRFVHRGYLVLPWL* |
| Ga0157379_116860212 | 3300014968 | Switchgrass Rhizosphere | ASERGRGAYRTPVNTAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVVLPRL* |
| Ga0132258_134310242 | 3300015371 | Arabidopsis Rhizosphere | GRGTYRTPANRAGIDLSDATFATLGLRDNDWIEWRFVHRGYIPLPRLSAALSPRD* |
| Ga0132256_1029189743 | 3300015372 | Arabidopsis Rhizosphere | PAAERGVGKYRTPSNRAGIDLSNAVFAELGLHDNDWVEWRFVHQGYMVLPWLSISNGY* |
| Ga0132255_1007845271 | 3300015374 | Arabidopsis Rhizosphere | DDYWSGGHRPAAEQGRGTYRKPANNAGIDLSDATFATLGLRDNDYVEWRFVHRGYVPLPRLGVATTADSR* |
| Ga0182041_123408491 | 3300016294 | Soil | PAAERGRGAFRRPANPAGIDLSDAVFASLGLADNDYLDWRFVHRGYVPLPRLAAAAGR |
| Ga0187809_103363561 | 3300017937 | Freshwater Sediment | ERGRGSFRTPTNRSGIDLSDATFAALGLRDNSTLEWRFVHRGYIPLPRVAIPTGP |
| Ga0184628_100337792 | 3300018083 | Groundwater Sediment | RTLANCAGIDLSDATFALLGLCDNDWVEWRFVHRGYVALPRVGLGPSP |
| Ga0213873_102559222 | 3300021358 | Rhizosphere | TPVNKAGIDLSDAVFAELGLTDNDYVDWRFVHRDYVALPFL |
| Ga0213876_105946861 | 3300021384 | Plant Roots | AYRTPVNTAGIDLSDAVFAELGLPDNDRVDWRFVEKGYVPLPEL |
| Ga0210389_103160703 | 3300021404 | Soil | TNRAGIDLSDATFAALGLRDNSPVEWRFVHRGYIPLPRAAIASGP |
| Ga0210387_100628724 | 3300021405 | Soil | AGIDLSDATFAALGLRDNSPVEWRFVHRGYIPLPRAAIAIGP |
| Ga0179589_104750692 | 3300024288 | Vadose Zone Soil | RPPVNTAGIDLSDAVFADLGLRDNDGVDWRFVHRGYIALPRL |
| Ga0207642_104972232 | 3300025899 | Miscanthus Rhizosphere | RGRGAYRTPVNKAGIDLSDAVFAELGLADNDYVDWRFVHRDYVALPFL |
| Ga0207705_112111691 | 3300025909 | Corn Rhizosphere | VNPAGIDLSDPVFAELGLRDNDTVEWRFVHRDFTLLPSL |
| Ga0207663_102132781 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DDPYWEHDARPASERGRGAYRTPVNHAGIDLSDPVFAELGLRDNDQVEWRFVHRDFTILPRL |
| Ga0207660_112046651 | 3300025917 | Corn Rhizosphere | YWSGSRRPAAERSHGYYRTPSNRAGIDLSDAVFHALGLRDNDWVEWRFVHKGYLVLPWL |
| Ga0207694_117951211 | 3300025924 | Corn Rhizosphere | DDYWSDSRRPASERNRGYYRSPTNRAGIDLSDAVFHQLGLRDNDWVEWRFVHKGYLALPA |
| Ga0207659_113440931 | 3300025926 | Miscanthus Rhizosphere | RGRGAYRTPANRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRLAAGPR |
| Ga0207644_114244261 | 3300025931 | Switchgrass Rhizosphere | GRGAYRTPANRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRMGTSTSTQSRR |
| Ga0207711_116533482 | 3300025941 | Switchgrass Rhizosphere | YRTPVNSAGIDLSDATFALLGLRDNDWVEWRFVHRGYVPLPRVAIGRH |
| Ga0207651_106264062 | 3300025960 | Switchgrass Rhizosphere | VNQAGIDLSDAVFAELGLSDNDYVDWRFVHRDYVAWPAL |
| Ga0207658_102364183 | 3300025986 | Switchgrass Rhizosphere | AYRTPANRAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRMGTSTSTQSRR |
| Ga0207702_117699271 | 3300026078 | Corn Rhizosphere | HHGYYRTPTNRAGIDLSDAVYASLGLHDNDVVEWRFVHRGYLVLPWL |
| Ga0207648_115287611 | 3300026089 | Miscanthus Rhizosphere | RAGIDLSDATFATLGLRDNDFVEWRFVHRGYIPFPRLAGRAILDR |
| Ga0207676_103009831 | 3300026095 | Switchgrass Rhizosphere | PYWEHDARPASERGRGAYRTPVNHAGIDLSDPVFAELGLRDNDQVEWRFVHRDFTILPRL |
| Ga0268265_118053621 | 3300028380 | Switchgrass Rhizosphere | TFATLGLRDNDFVEWRFVHRGYIPFPRLAGRAILDR |
| Ga0268264_123141282 | 3300028381 | Switchgrass Rhizosphere | ERGHGAYRTPVNTAGIDLSDAVFAALGLPDNDVVDWRFVHRKVVPDTAIQH |
| Ga0307503_103855422 | 3300028802 | Soil | PVNRAGIDLSDATFATLGLRDNDTVEWRFVHRGYVPLPRLAIGNR |
| Ga0302259_100029210 | 3300028861 | Fen | YRTPVNTAGIDLSDPVFAALGLPDNDYVDWRFVHRGYVALPHL |
| Ga0302254_100501503 | 3300028870 | Fen | PVNKAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVALPRL |
| Ga0311347_108129293 | 3300029923 | Fen | PASERGRGYYRTPVNKAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVALPRL |
| Ga0302298_102859941 | 3300029980 | Fen | GRGYYRTPVNTAGIDLSDPVFAALGLPDNDYVDWRFVHRGYVALPHL |
| Ga0311332_101238203 | 3300029984 | Fen | DRPASERGRGYYRTPVNKAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVALPRL |
| Ga0311332_117594692 | 3300029984 | Fen | GAYRTPVNTAGIDLSDPVFAELDMRDNDVVEWRFVHRDFTVLPRL |
| Ga0302299_101859201 | 3300030010 | Fen | ASERGRGAYRTPVNPAGIDLSDPVFAELDMRDNDVVEWRFVHRDFTVLPRL |
| Ga0311349_101764123 | 3300030294 | Fen | GRGSFRNPTNHAGIDLSDATFAALGLRDNSPVEWRFVHRGYIPLPRAAIATGP |
| Ga0307496_100098101 | 3300031200 | Soil | WERDGRPASERGHGAYRTPVNTAGIDLSDAVFAELDLRDNDMVDWRFVHRDYVVLPRL |
| Ga0265332_102221431 | 3300031238 | Rhizosphere | RPASERGRGAYRTPVNRAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVVLPRL |
| Ga0265331_101464692 | 3300031250 | Rhizosphere | PWNIDDAYWETGARPAAERGRGAYRTPANHAGIDLSDGVFFALGLRDNDYLEWRFVHRGYIPLPRM |
| Ga0307509_108154642 | 3300031507 | Ectomycorrhiza | RGRGRYRRPVNTAGIDLSDAVFAALGLPDNDIVEWRFVHRDYVVLPRL |
| Ga0307508_103245482 | 3300031616 | Ectomycorrhiza | GPWNVDDAYWEHAARPASERGRGAYRTPVNTAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVVLPRL |
| Ga0318561_105784691 | 3300031679 | Soil | GQRPAAERGRGAFRRPANPAGIDLSDAVFASLGLADNDYLDWRFVHRGYVPLPRLAAAAG |
| Ga0265342_105547061 | 3300031712 | Rhizosphere | PWNVDDDYWATGRRPAAERGSGSYRRPTNQAGIDLSDATFAALGLRDNTTLEWRFVHRGYIPLPRVAIPTGP |
| Ga0307476_100819923 | 3300031715 | Hardwood Forest Soil | AYRTPVNRAGIDLSDAVFATLGLPDNDVVDWRFVHRGYVVLPRL |
| Ga0318493_100611141 | 3300031723 | Soil | YWRTGQRPAAERGRGAFRRPANPAGIDLSDAVFASLGLADNDYLDWRFVHRGYVPLPRLAAAAGR |
| Ga0318500_107197032 | 3300031724 | Soil | AAERGRGAFRRPANPAGIDLSDAVFASLGLADNDYLDWRFVHRGYVPLPRLAAAAGR |
| Ga0318546_112028002 | 3300031771 | Soil | AFRRPANPAGIDLSDAVFASLGLADNDYLDWRFVHRGYVPLPRLAAAAGR |
| Ga0318497_102912521 | 3300031805 | Soil | ESSRRPASERGQGTYRRPTNPAGIDLSDAVFASLGMHNNDVVEWRFVHRGYIPLPRVSIAAGLSAVSPSPEPR |
| Ga0310909_112416341 | 3300031947 | Soil | QRPASERGRGAFRRPANPAGIDLSDAVFASLGLADNDYLDWRFVHRGYVPLPRLAAAAGR |
| Ga0310911_104024921 | 3300032035 | Soil | NVDDAYWRTGQRPAAERGRGAFRRPANPAGIDLSDAVFASLGLADNDYLDWRFVHRGYVPLPRLAAAAGR |
| Ga0308173_109862941 | 3300032074 | Soil | PSNAAGIDLSDATFTALGMRDNAILEWRFVHRGYIPLPRVSIPARVQ |
| Ga0308173_110710112 | 3300032074 | Soil | DARPASERGRGAYRTPANPAGIDLSDAVFAELGLADNDYVTWRFVHRGYVALPFL |
| Ga0308173_116041471 | 3300032074 | Soil | SGIDLSDATFAALGLRDNSTLEWRFVHRGYIPLPRVAIPTGP |
| Ga0306924_117438812 | 3300032076 | Soil | RPAAERGIGVYRRPSNRAGIDLSDAVFATLGLHDNDFVEWRFVHRGYVVFPRL |
| Ga0307471_1009792441 | 3300032180 | Hardwood Forest Soil | GRGAYRTPVNTAGIDLSDAVFAALGLPDNDVVDWRFVHRGYVVLPRL |
| Ga0373909_0215340_1_108 | 3300034191 | Sediment Slurry | GIDLSDAVFAALGLRDNDVVDWRFVHRGYVALPRL |
| ⦗Top⦘ |