


| Basic Information | |
|---|---|
| Family ID | F100574 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQSDRKSRLITICMLARALVMIGLALTGTLQMRVSRSPVAQVVT |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.37 % |
| % of genes near scaffold ends (potentially truncated) | 68.63 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.588 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.510 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.098 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.745 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 11.76 |
| PF04780 | DUF629 | 5.88 |
| PF00589 | Phage_integrase | 4.90 |
| PF13460 | NAD_binding_10 | 1.96 |
| PF00550 | PP-binding | 0.98 |
| PF14659 | Phage_int_SAM_3 | 0.98 |
| PF13374 | TPR_10 | 0.98 |
| PF04964 | Flp_Fap | 0.98 |
| PF06823 | DUF1236 | 0.98 |
| PF12697 | Abhydrolase_6 | 0.98 |
| PF04134 | DCC1-like | 0.98 |
| PF04191 | PEMT | 0.98 |
| PF01068 | DNA_ligase_A_M | 0.98 |
| PF00753 | Lactamase_B | 0.98 |
| PF01650 | Peptidase_C13 | 0.98 |
| PF01243 | Putative_PNPOx | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 11.76 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.98 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.98 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.98 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.98 |
| COG5206 | Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8 | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.59 % |
| Unclassified | root | N/A | 29.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_104601261 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300000956|JGI10216J12902_108186101 | Not Available | 527 | Open in IMG/M |
| 3300005181|Ga0066678_10780989 | Not Available | 633 | Open in IMG/M |
| 3300005332|Ga0066388_100145636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2940 | Open in IMG/M |
| 3300005332|Ga0066388_103915486 | Not Available | 759 | Open in IMG/M |
| 3300005332|Ga0066388_104269567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300005363|Ga0008090_10221792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1528 | Open in IMG/M |
| 3300005713|Ga0066905_100090832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2041 | Open in IMG/M |
| 3300005713|Ga0066905_100321370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1224 | Open in IMG/M |
| 3300005713|Ga0066905_100659126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300005713|Ga0066905_100882406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300005713|Ga0066905_101164777 | Not Available | 687 | Open in IMG/M |
| 3300005713|Ga0066905_102108785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300005764|Ga0066903_102961340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 920 | Open in IMG/M |
| 3300005764|Ga0066903_103151030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300005764|Ga0066903_103483351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300005764|Ga0066903_104857353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300005764|Ga0066903_105493134 | Not Available | 668 | Open in IMG/M |
| 3300005764|Ga0066903_105818468 | Not Available | 647 | Open in IMG/M |
| 3300005764|Ga0066903_106248887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300005764|Ga0066903_107393692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300005764|Ga0066903_108609364 | Not Available | 519 | Open in IMG/M |
| 3300005764|Ga0066903_109092941 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006852|Ga0075433_10922085 | Not Available | 762 | Open in IMG/M |
| 3300009792|Ga0126374_10023728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2746 | Open in IMG/M |
| 3300010043|Ga0126380_10461368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 963 | Open in IMG/M |
| 3300010043|Ga0126380_11415392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300010046|Ga0126384_10013209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5196 | Open in IMG/M |
| 3300010046|Ga0126384_11426219 | Not Available | 646 | Open in IMG/M |
| 3300010047|Ga0126382_10046275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2516 | Open in IMG/M |
| 3300010047|Ga0126382_10650243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300010048|Ga0126373_12850846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300010358|Ga0126370_10095229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2043 | Open in IMG/M |
| 3300010360|Ga0126372_10927450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300010361|Ga0126378_10658171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1160 | Open in IMG/M |
| 3300010366|Ga0126379_10055154 | All Organisms → cellular organisms → Bacteria | 3298 | Open in IMG/M |
| 3300010376|Ga0126381_104148446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300010376|Ga0126381_104800955 | Not Available | 520 | Open in IMG/M |
| 3300010398|Ga0126383_10331754 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300010398|Ga0126383_12030331 | Not Available | 662 | Open in IMG/M |
| 3300010398|Ga0126383_13436168 | Not Available | 517 | Open in IMG/M |
| 3300012198|Ga0137364_10687681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300012199|Ga0137383_10469733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 921 | Open in IMG/M |
| 3300012201|Ga0137365_10282211 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300012205|Ga0137362_10016940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5521 | Open in IMG/M |
| 3300012209|Ga0137379_10126924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2452 | Open in IMG/M |
| 3300012361|Ga0137360_11409240 | Not Available | 600 | Open in IMG/M |
| 3300012948|Ga0126375_12013520 | Not Available | 511 | Open in IMG/M |
| 3300012971|Ga0126369_11158808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300016270|Ga0182036_11754054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300016357|Ga0182032_10710402 | Not Available | 844 | Open in IMG/M |
| 3300016357|Ga0182032_11428535 | Not Available | 599 | Open in IMG/M |
| 3300016404|Ga0182037_10168883 | Not Available | 1668 | Open in IMG/M |
| 3300016422|Ga0182039_10479062 | Not Available | 1071 | Open in IMG/M |
| 3300016422|Ga0182039_10520311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300016422|Ga0182039_10739173 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300018468|Ga0066662_10277538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1391 | Open in IMG/M |
| 3300021560|Ga0126371_12500467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300021560|Ga0126371_12606031 | Not Available | 612 | Open in IMG/M |
| 3300021560|Ga0126371_13886485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300025910|Ga0207684_10474403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1073 | Open in IMG/M |
| 3300026320|Ga0209131_1177192 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300026557|Ga0179587_10121225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1605 | Open in IMG/M |
| 3300031561|Ga0318528_10061915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1912 | Open in IMG/M |
| 3300031573|Ga0310915_10084815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2113 | Open in IMG/M |
| 3300031679|Ga0318561_10492581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031719|Ga0306917_10391853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300031720|Ga0307469_11407606 | Not Available | 665 | Open in IMG/M |
| 3300031723|Ga0318493_10851283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031724|Ga0318500_10239664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300031736|Ga0318501_10020647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2763 | Open in IMG/M |
| 3300031744|Ga0306918_10704507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300031765|Ga0318554_10754475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300031779|Ga0318566_10469158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031796|Ga0318576_10279911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300031846|Ga0318512_10658939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031859|Ga0318527_10345544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300031890|Ga0306925_12035001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300031912|Ga0306921_10758205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28 | 1111 | Open in IMG/M |
| 3300031912|Ga0306921_10813154 | Not Available | 1067 | Open in IMG/M |
| 3300031942|Ga0310916_10244671 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300031942|Ga0310916_11031292 | Not Available | 685 | Open in IMG/M |
| 3300031946|Ga0310910_10599825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 873 | Open in IMG/M |
| 3300031947|Ga0310909_10291738 | Not Available | 1366 | Open in IMG/M |
| 3300031954|Ga0306926_10534707 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300031954|Ga0306926_11770323 | Not Available | 702 | Open in IMG/M |
| 3300032001|Ga0306922_10555994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1219 | Open in IMG/M |
| 3300032025|Ga0318507_10191344 | Not Available | 882 | Open in IMG/M |
| 3300032039|Ga0318559_10149971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300032042|Ga0318545_10183989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300032051|Ga0318532_10134287 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300032059|Ga0318533_10225449 | Not Available | 1349 | Open in IMG/M |
| 3300032063|Ga0318504_10485673 | Not Available | 591 | Open in IMG/M |
| 3300032063|Ga0318504_10515316 | Not Available | 573 | Open in IMG/M |
| 3300032064|Ga0318510_10080035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1212 | Open in IMG/M |
| 3300032094|Ga0318540_10436566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300032180|Ga0307471_101244229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300032180|Ga0307471_102298241 | Not Available | 680 | Open in IMG/M |
| 3300032205|Ga0307472_101959192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300032261|Ga0306920_101708827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300033290|Ga0318519_10611315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 21.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1046012611 | 3300000956 | Soil | KSQLITICMLIGALAMIGLTLTGTLQMRVSQSPVAVLAR* |
| JGI10216J12902_1081861011 | 3300000956 | Soil | MRSDPKSRLITICMLAAAVVMIGLALTGTLQMRVSR |
| Ga0066678_107809892 | 3300005181 | Soil | MSERKSRLITICMLAGAVVMIGLVLTGTLQMKVSRSPVAQVVTK* |
| Ga0066388_1001456364 | 3300005332 | Tropical Forest Soil | MQRDRKSRLITICMLAGAMIGLVLTGTLQIRVSHSPLAYIVTK* |
| Ga0066388_1039154862 | 3300005332 | Tropical Forest Soil | MQSDRKSRLITICMLAGAVVMIGLVLTGTLQMRVSHSPVAVLAR* |
| Ga0066388_1042695672 | 3300005332 | Tropical Forest Soil | MQSERKSRLITICMLASALIMIGLVLTGTLQMRVLRSPVTQLVTK* |
| Ga0008090_102217921 | 3300005363 | Tropical Rainforest Soil | MSDRNSQLITICMLIGALAIIGLVLTGTLQMRVPQSPVAVLTR* |
| Ga0066905_1000908323 | 3300005713 | Tropical Forest Soil | MSDLKSRVITICMLVGALAMIGLVLTGTLQMRVSHSPVVAVVGQ* |
| Ga0066905_1003213702 | 3300005713 | Tropical Forest Soil | MQNDRRSRLITICMLAGAVVMIGLVLTGTLQIRVSHSPIAYVVIK* |
| Ga0066905_1006591262 | 3300005713 | Tropical Forest Soil | MSDRNSQLITICMLIGALAIIGLALTGTLQMRVSQSPVAALTR* |
| Ga0066905_1008824061 | 3300005713 | Tropical Forest Soil | MRSDRKSRLITICMLASAIVMIGLALTGTLQMRVSHSPITALS |
| Ga0066905_1011647772 | 3300005713 | Tropical Forest Soil | MRSDRKSRLITICMLASAIVMIGLALTGTLQMRVSHSPIT |
| Ga0066905_1021087851 | 3300005713 | Tropical Forest Soil | MRSDRKSRLITICMLASAIVMIGLALTGTLQMRVS |
| Ga0066903_1029613402 | 3300005764 | Tropical Forest Soil | MQSDRKSRLITICMLASALVMIGLALTGTLQMRVSHS |
| Ga0066903_1031510301 | 3300005764 | Tropical Forest Soil | MQSYRKSRLITICMLAGAVVMIGLVLTGTLQIRVSHSPLAYVVTK* |
| Ga0066903_1034833512 | 3300005764 | Tropical Forest Soil | MQSDRKGRLITICMLAGAIVMIGLVLAGTLQMRVSHAQVAVVAR* |
| Ga0066903_1048573532 | 3300005764 | Tropical Forest Soil | MSNRNSQLITICMLIGALAIIGLALTGALQMRVSQSPVAALTR* |
| Ga0066903_1054931342 | 3300005764 | Tropical Forest Soil | VMQSERKSQLITICMLASALVIIGLVLTGTLQMRVLRSPVAQLVTK* |
| Ga0066903_1058184681 | 3300005764 | Tropical Forest Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQMRVLR |
| Ga0066903_1062488871 | 3300005764 | Tropical Forest Soil | EPFVMRSDPKSRLITICMLAAAVVMIGLALTGTLQMRVSHSPIAYVVTK* |
| Ga0066903_1073936922 | 3300005764 | Tropical Forest Soil | ITICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK* |
| Ga0066903_1086093641 | 3300005764 | Tropical Forest Soil | MQSERKSRLITICMLAGALVMIGLVLTGTLQMRVLRSPVTQLVTK* |
| Ga0066903_1090929412 | 3300005764 | Tropical Forest Soil | ICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK* |
| Ga0075433_109220852 | 3300006852 | Populus Rhizosphere | MSDLKGRLITICMLVGALAMIGLVLTGTLQLRVSRSPVAQIAIK* |
| Ga0126374_100237281 | 3300009792 | Tropical Forest Soil | MSNRNSQLITICMLIGALAIIGLALTGTLQMRVSQSP |
| Ga0126380_104613683 | 3300010043 | Tropical Forest Soil | VMSDRNSQLITICMLIGALAIIGLALTGTLQMRVSQSPVAVLTR* |
| Ga0126380_114153921 | 3300010043 | Tropical Forest Soil | MSDLKSRVITICMLVGALAVIGVVLTGTLQMRVSHSPVVAVVGQ* |
| Ga0126384_1001320912 | 3300010046 | Tropical Forest Soil | MSNRNSQLITICMLIGALAIIGLALTGTLQMRVSQSPVA |
| Ga0126384_114262192 | 3300010046 | Tropical Forest Soil | MQSDRKSQLITICMLIGALAMIGLALTGTLQIRVSNSPIAYVVTK* |
| Ga0126382_100462754 | 3300010047 | Tropical Forest Soil | MSDRNSQLITIRMLIGALAIIGLALTGTLQMRVSQSPVAVLTR* |
| Ga0126382_106502433 | 3300010047 | Tropical Forest Soil | PLFVMSDRNSQLITICMLIGALAIIGLVLTGTLQMRVSQSPVAVLTR* |
| Ga0126373_128508462 | 3300010048 | Tropical Forest Soil | MQSDRKSRLITICMLARALVMIGLALTGTLQMRVSRSPVAQVVT |
| Ga0126370_100952292 | 3300010358 | Tropical Forest Soil | MQSDRKSRLIAICMLAGAVVMIGLALTGTLQMRVSRSPIVYVVTK* |
| Ga0126372_109274501 | 3300010360 | Tropical Forest Soil | MSDRNSQLITICMLIGALAIIGLALTGTLQMRVSQSPVA |
| Ga0126378_106581711 | 3300010361 | Tropical Forest Soil | TICMLASALIMIGLVLTGTLQMRVLRSPVTQLVTK* |
| Ga0126379_100551543 | 3300010366 | Tropical Forest Soil | MSDRKSGLITICMLIGAVVMIGLVLTGTLQMRVLRSPVTQLVTK* |
| Ga0126381_1041484461 | 3300010376 | Tropical Forest Soil | MRSDRKSRLITICMLASALVMIGLALTGTLQMRVSHSPKL |
| Ga0126381_1048009551 | 3300010376 | Tropical Forest Soil | MSDRKSQFIAICMFIGAVTMIGLALTGTLRMRVVH |
| Ga0126383_103317541 | 3300010398 | Tropical Forest Soil | LITICMLIGAVVMIGLVLTGTLQMRVLRSPVTQLVTK* |
| Ga0126383_120303311 | 3300010398 | Tropical Forest Soil | MQSERKSRLITICMLASALVMIGLALSGTLQMRVSRSPVAQVVTK* |
| Ga0126383_134361681 | 3300010398 | Tropical Forest Soil | LLCYRKSRLITICMLASAIVMIGLALTGTLQMRVSHSPITA |
| Ga0137364_106876812 | 3300012198 | Vadose Zone Soil | MSELKDRLITICMLVGAFAMIGLVLTGTLQMRVSHSPVAVVTR* |
| Ga0137383_104697332 | 3300012199 | Vadose Zone Soil | MSEPKDRLITICMLIGAFAMIGLALTGTLQMRVSHSPVVVVTR* |
| Ga0137365_102822113 | 3300012201 | Vadose Zone Soil | MSELKDRLITICMLVGAFAMIGLALTGSLQIRVSHSPVAVVTR* |
| Ga0137362_100169403 | 3300012205 | Vadose Zone Soil | MRDRKSQLITICMLIGALAIIGLALTGTLQMRVSRSPVAQVVIK* |
| Ga0137379_101269243 | 3300012209 | Vadose Zone Soil | MSERKSRLITICMLAGAVVMIGLVLTGTLQMKVSRS |
| Ga0137360_114092402 | 3300012361 | Vadose Zone Soil | MSERKSRLITICMLAGAVVMIGLVLTDTLQMKVSRSPVAQVVTK* |
| Ga0126375_120135201 | 3300012948 | Tropical Forest Soil | LITICMLAGAVLMIGLVLTGTLQIRVSNSPIAYVVTK* |
| Ga0126369_111588081 | 3300012971 | Tropical Forest Soil | MQSDRKSRLITICMLAGAVVMIGLVLTGTLQIRVSHSPIAYVVTK* |
| Ga0182036_117540541 | 3300016270 | Soil | MQSDRKSRLITICMLASALVMIEALTGTLQMRVSHSPKLVSSQ |
| Ga0182032_107104021 | 3300016357 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRSPV |
| Ga0182032_114285352 | 3300016357 | Soil | FVMQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0182037_101688831 | 3300016404 | Soil | GGPFVMQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0182039_104790622 | 3300016422 | Soil | ERKSRLITICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0182039_105203112 | 3300016422 | Soil | FVMSDRNSQLITICMLIGALAIIGLVLTGTLQMRVSQPPVAVLTR |
| Ga0182039_107391731 | 3300016422 | Soil | RKSQLITICMLASALVIIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0066662_102775382 | 3300018468 | Grasslands Soil | MSERKSRLITICMLAGAVVMIGLVLTGTLQMKVSRSPVAQVVTK |
| Ga0126371_125004672 | 3300021560 | Tropical Forest Soil | MQSERKSRLITICMLARALVMIGLALTGTLQMRVSHSPKLVSSQ |
| Ga0126371_126060311 | 3300021560 | Tropical Forest Soil | PLFVMSDRNSQLITICMLIGALAIIGLALTGTLQMRVSQSPVAVLTR |
| Ga0126371_138864852 | 3300021560 | Tropical Forest Soil | MQSDRKSRLITICMLASALVMIGLALTGTLQMRVSHSP |
| Ga0207684_104744032 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSDRKSRLIAICMLAGAVVMIGLALTGTLQMRVSRSSVTQVVTIVTK |
| Ga0209131_11771921 | 3300026320 | Grasslands Soil | KSQLITICMLIGALAIIGLALTGTLQMRVSRSPVAQVVIK |
| Ga0179587_101212251 | 3300026557 | Vadose Zone Soil | CYAMRDRKSQLITICMLIGALAIIGLALTGTLQMRVSRSPVAQVVIK |
| Ga0318528_100619153 | 3300031561 | Soil | MSDRNSQLITICMLIGALAIFGLALTGTLQMRVSQSPVAVLTR |
| Ga0310915_100848154 | 3300031573 | Soil | QLITICMLIGALAIFGLALTGTLQMRVSQSPVAVLTR |
| Ga0318561_104925812 | 3300031679 | Soil | MSDRNSQLITICMLIGALAIIGLVLTGTLQMRVSQSPVAVLTR |
| Ga0306917_103918533 | 3300031719 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQIRVLRSPVIQL |
| Ga0307469_114076061 | 3300031720 | Hardwood Forest Soil | MSDLKGRLITICMLVGALAMIGLVLTGTLQLRGSRSPVAQIAIK |
| Ga0318493_108512832 | 3300031723 | Soil | MQSDRKSRLITICMLASALVMIGLALTGTLQMRVSHSPITRVVPN |
| Ga0318500_102396641 | 3300031724 | Soil | MQSERKSQLITICMLASALVIIGLVLTGTLQMRVLRSPVT |
| Ga0318501_100206472 | 3300031736 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0306918_107045072 | 3300031744 | Soil | MSDRNSQLITICMLIGALAIIGLVLTGTLQMRVSQPPVA |
| Ga0306918_113979962 | 3300031744 | Soil | DRKSRLITICMLASAIVMIGLALTGTLQMRVSHSPITALSQIDRP |
| Ga0318554_107544751 | 3300031765 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQIRVLR |
| Ga0318566_104691582 | 3300031779 | Soil | MQSDRKSRLITICMLASALVMIGLALTGTLQMRVSH |
| Ga0318576_102799111 | 3300031796 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRSPVT |
| Ga0318512_106589391 | 3300031846 | Soil | ERKSRLITICMLASALIMIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0318527_103455443 | 3300031859 | Soil | QLITICMLASALVIVGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0306925_120350012 | 3300031890 | Soil | MQSDRKSRLITICMLASALVMIGLALTGTLQMRVSHSPKLVS |
| Ga0306921_107582051 | 3300031912 | Soil | SDRKSRLITICMLASALVMIGLALTGILQMRVSHSPITRVVPN |
| Ga0306921_108131541 | 3300031912 | Soil | MSDRNSQLITICMLIGALAIIGLVLTGTLQMRVSQPPVAVLTR |
| Ga0310916_102446711 | 3300031942 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRS |
| Ga0310916_110312921 | 3300031942 | Soil | MRSDRKSRLITICMLASAIVMIGLALTGTLQMRVSHSTIT |
| Ga0310910_105998251 | 3300031946 | Soil | ITICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0310909_102917383 | 3300031947 | Soil | LFVMSDRNSQLITICMLIGALAIIGLVLTGTLQMRVS |
| Ga0306926_105347072 | 3300031954 | Soil | MRSDRKSRLITICMLASAIVMIGLALTGTLQMRVSH |
| Ga0306926_117703233 | 3300031954 | Soil | NGEPFVMQSERKSQLITICMLASALVIIGLVLTGTLQMRVLRSPVAQLVTK |
| Ga0306922_105559941 | 3300032001 | Soil | ITICMLIGALAIIGLVLTGTLQMRVSQSPVAVLTR |
| Ga0318507_101913443 | 3300032025 | Soil | VMQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0318559_101499713 | 3300032039 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQIRVLRSPVI |
| Ga0318545_101839892 | 3300032042 | Soil | MRSDRKSRLITICMLASAIVMIGLALTGTLQMRVSHSPI |
| Ga0318532_101342871 | 3300032051 | Soil | GEPIVMQSERKSQLITICMLASALVIIGLVLTGTLQMRVLRSPVTQLVTK |
| Ga0318533_102254493 | 3300032059 | Soil | MQSERKSRLITICMLASALVMIGLVLTGTLQMRVLRSP |
| Ga0318504_104856732 | 3300032063 | Soil | MQSDRKSRLITICMLASALVMIEALTGTLQMRVSHSPKLV |
| Ga0318504_105153162 | 3300032063 | Soil | MQSDHKSQLITICMLIGALATIGFALTGTLQMRVS |
| Ga0318510_100800351 | 3300032064 | Soil | MQSDRKSRLITICMLASALVMIGLALTGNLQMRVSHSPKLVSSQ |
| Ga0318540_104365661 | 3300032094 | Soil | MQSERKSQLITICMLASALVIVGLVLTGTLQMRVLRSPVT |
| Ga0307471_1012442293 | 3300032180 | Hardwood Forest Soil | MQSDRKSRLITICMLAGALVMIGLVLSGTLQLRVS |
| Ga0307471_1022982412 | 3300032180 | Hardwood Forest Soil | MSDRKSQLITICMLIGALAMIGLALTGALQMRVSHSPVAVLAR |
| Ga0307472_1019591921 | 3300032205 | Hardwood Forest Soil | MQSDLKSRLTTICMLAGALVMIGLVLTGTLQLRVSRSPTAYVATK |
| Ga0306920_1017088271 | 3300032261 | Soil | MRSDRKSRLITICMLASAIVMIGLALTGTLQMRVSHSPFT |
| Ga0318519_106113151 | 3300033290 | Soil | VMQSERKSQLITICMLASALVIIGLVLTGTLQMRVLRSPVTQLVTK |
| ⦗Top⦘ |