


| Basic Information | |
|---|---|
| Family ID | F100553 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVWANLR |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.71 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.510 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.686 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.451 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.078 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF03480 | DctP | 27.45 |
| PF00580 | UvrD-helicase | 19.61 |
| PF09298 | FAA_hydrolase_N | 14.71 |
| PF03949 | Malic_M | 10.78 |
| PF13361 | UvrD_C | 5.88 |
| PF04209 | HgmA_C | 4.90 |
| PF03401 | TctC | 1.96 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.98 |
| PF02875 | Mur_ligase_C | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 19.61 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 19.61 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 19.61 |
| COG0179 | 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 14.71 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 10.78 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 10.78 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.90 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.51 % |
| Unclassified | root | N/A | 25.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10132326 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10033678 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300002907|JGI25613J43889_10115554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300004281|Ga0066397_10011097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300005163|Ga0066823_10001688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2593 | Open in IMG/M |
| 3300005330|Ga0070690_100256998 | Not Available | 1238 | Open in IMG/M |
| 3300005363|Ga0008090_10007098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
| 3300005367|Ga0070667_101117481 | Not Available | 737 | Open in IMG/M |
| 3300005435|Ga0070714_100410405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300005436|Ga0070713_101550698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 643 | Open in IMG/M |
| 3300005440|Ga0070705_100120251 | Not Available | 1695 | Open in IMG/M |
| 3300005455|Ga0070663_100301499 | Not Available | 1283 | Open in IMG/M |
| 3300005468|Ga0070707_100617699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300005468|Ga0070707_102211194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300005559|Ga0066700_10328941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1079 | Open in IMG/M |
| 3300005561|Ga0066699_10918433 | Not Available | 610 | Open in IMG/M |
| 3300005562|Ga0058697_10460385 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005564|Ga0070664_100073236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2939 | Open in IMG/M |
| 3300005569|Ga0066705_10171079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1346 | Open in IMG/M |
| 3300005587|Ga0066654_10374264 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005713|Ga0066905_100546703 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005713|Ga0066905_101303384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300005764|Ga0066903_101252633 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300005764|Ga0066903_106228329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300005764|Ga0066903_106396402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300005842|Ga0068858_100154695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2157 | Open in IMG/M |
| 3300006028|Ga0070717_10777319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300006854|Ga0075425_102838953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 532 | Open in IMG/M |
| 3300006881|Ga0068865_101291707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300009038|Ga0099829_10179366 | Not Available | 1704 | Open in IMG/M |
| 3300009090|Ga0099827_10210426 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300009792|Ga0126374_10458230 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010043|Ga0126380_11559694 | Not Available | 587 | Open in IMG/M |
| 3300010046|Ga0126384_10368215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300010046|Ga0126384_10586008 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300010046|Ga0126384_10973729 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300010048|Ga0126373_11406965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300010336|Ga0134071_10525588 | Not Available | 613 | Open in IMG/M |
| 3300010359|Ga0126376_11213491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300010360|Ga0126372_10288874 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300010366|Ga0126379_10853648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1011 | Open in IMG/M |
| 3300010376|Ga0126381_101209286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300010376|Ga0126381_102329608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300010398|Ga0126383_10622749 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300010400|Ga0134122_12567544 | Not Available | 559 | Open in IMG/M |
| 3300012199|Ga0137383_10808200 | Not Available | 684 | Open in IMG/M |
| 3300012203|Ga0137399_11255012 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012207|Ga0137381_11779542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300012211|Ga0137377_10691980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300012361|Ga0137360_11513773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300012362|Ga0137361_10085771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2703 | Open in IMG/M |
| 3300012363|Ga0137390_10368319 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300012902|Ga0157291_10331320 | Not Available | 539 | Open in IMG/M |
| 3300012906|Ga0157295_10385182 | Not Available | 518 | Open in IMG/M |
| 3300012948|Ga0126375_11320221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300012951|Ga0164300_10647430 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012955|Ga0164298_10369168 | Not Available | 916 | Open in IMG/M |
| 3300012971|Ga0126369_13316014 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300013306|Ga0163162_12063503 | Not Available | 654 | Open in IMG/M |
| 3300013307|Ga0157372_13202772 | Not Available | 522 | Open in IMG/M |
| 3300014968|Ga0157379_11642155 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300016319|Ga0182033_11215066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300016341|Ga0182035_10682816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300016341|Ga0182035_11940957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300016357|Ga0182032_10675729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300016371|Ga0182034_10373097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300016404|Ga0182037_10620448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
| 3300016404|Ga0182037_11330406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300016422|Ga0182039_11489723 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300017792|Ga0163161_11254970 | Not Available | 643 | Open in IMG/M |
| 3300018027|Ga0184605_10063044 | Not Available | 1594 | Open in IMG/M |
| 3300019789|Ga0137408_1104292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300019875|Ga0193701_1003901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2766 | Open in IMG/M |
| 3300019886|Ga0193727_1101608 | Not Available | 847 | Open in IMG/M |
| 3300021170|Ga0210400_11523691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300021968|Ga0193698_1021791 | Not Available | 839 | Open in IMG/M |
| 3300025321|Ga0207656_10355275 | Not Available | 732 | Open in IMG/M |
| 3300025898|Ga0207692_10772728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300025915|Ga0207693_11163964 | Not Available | 583 | Open in IMG/M |
| 3300025934|Ga0207686_10662536 | Not Available | 827 | Open in IMG/M |
| 3300025960|Ga0207651_10941084 | Not Available | 770 | Open in IMG/M |
| 3300025986|Ga0207658_10790579 | Not Available | 861 | Open in IMG/M |
| 3300027875|Ga0209283_10844663 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300028807|Ga0307305_10401428 | Not Available | 619 | Open in IMG/M |
| 3300031748|Ga0318492_10319875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300031751|Ga0318494_10843196 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031763|Ga0318537_10044878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1595 | Open in IMG/M |
| 3300031771|Ga0318546_10532026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300031805|Ga0318497_10354546 | Not Available | 819 | Open in IMG/M |
| 3300031860|Ga0318495_10446434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300031890|Ga0306925_11933329 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031894|Ga0318522_10001295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5905 | Open in IMG/M |
| 3300031912|Ga0306921_10570220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300031942|Ga0310916_10639498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
| 3300032025|Ga0318507_10289678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300032025|Ga0318507_10359033 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300032055|Ga0318575_10044012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2020 | Open in IMG/M |
| 3300032060|Ga0318505_10138830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
| 3300032063|Ga0318504_10036775 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300032065|Ga0318513_10528304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300032067|Ga0318524_10339447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300032180|Ga0307471_100697114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.98% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_101323261 | 3300000597 | Forest Soil | MPSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVWAN |
| AF_2010_repII_A001DRAFT_100336781 | 3300000793 | Forest Soil | MPSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVW |
| JGI25613J43889_101155542 | 3300002907 | Grasslands Soil | MPSKTDLCVIASADLQRFASHLFVAAGVAPAMADEWAKSLVWANLRGV |
| Ga0066397_100110971 | 3300004281 | Tropical Forest Soil | MPSDTKLHVIPSADLQRFASALFEAAGVARSMADEWAKSLVWANLR |
| Ga0066823_100016882 | 3300005163 | Soil | MPPTSNDVHLISGSDLQRFASGLFQALGVAGPMADEWARSLVWANLRGVDS |
| Ga0070690_1002569981 | 3300005330 | Switchgrass Rhizosphere | MPPTSDVHLISGSDLQRFASALFQALGVAGPMADEWARSL |
| Ga0008090_100070981 | 3300005363 | Tropical Rainforest Soil | MPSKNESHVISSADLERFASALFAAAGVAPAMADEWAKSLVWANLRGVDS |
| Ga0070667_1011174812 | 3300005367 | Switchgrass Rhizosphere | MPPTSELHLIAGSDLQRFASALFQALGVAGPMADEWAKSL |
| Ga0070714_1004104052 | 3300005435 | Agricultural Soil | MPSDSKLHVIASADLQRFASALFAAAGVAPPMADEWAKSLVWANLRGV |
| Ga0070713_1015506981 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGKNELHVIRGDDLRRFVSGLFQALEVAPAMADEWATSLVWANLRGVD |
| Ga0070705_1001202511 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPTSDDVHLISGSDLQRFASALFQALGVAGPMADEWARSL |
| Ga0070663_1003014992 | 3300005455 | Corn Rhizosphere | MPPTSNDVHLIAGSDLQRFASALFQALGVAGPMADEWARSL |
| Ga0070707_1006176992 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSDSKLHVIASADLQRFASALFAAAGVAPPMADEWAKSLVWANLRG |
| Ga0070707_1022111941 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVWANLRGVD |
| Ga0066700_103289412 | 3300005559 | Soil | MKPKTELHVISSADLHRFASALFATAGVVPAMAEEWAKSLVWANLRGVDSH |
| Ga0066699_109184331 | 3300005561 | Soil | MKSKTELHVISSADLHRFASALFAAARVAPAMAEEWAKSLV |
| Ga0058697_104603851 | 3300005562 | Agave | MLKASGMPPKLESQVISSADLERFASALFQAAGVAPSMADEWAK |
| Ga0070664_1000732363 | 3300005564 | Corn Rhizosphere | MPPTSNDVHLIAGSDLQRFASALFQALGVAGPMADEWARSLVW |
| Ga0066705_101710791 | 3300005569 | Soil | MKPKTELHVISSADLHRFASALFAAAGVVPAMAEEWAKSLVWANLRG |
| Ga0066654_103742641 | 3300005587 | Soil | MPSNTGSHVISSADLERFARALFVAVGVAPAMAEEWAKSLIWANL |
| Ga0066905_1005467032 | 3300005713 | Tropical Forest Soil | MPSDTKLHVIPSADLQHFARALFEAAGVAPPMADQWAKSLVWANL |
| Ga0066905_1013033842 | 3300005713 | Tropical Forest Soil | MPSELEVQVIPSADLQHFARALFEAAGVAPPMADQWAKSLVWANLRGV |
| Ga0066903_1012526332 | 3300005764 | Tropical Forest Soil | MASNSELHVIAAPDLERFASALFQALDVERSMADE |
| Ga0066903_1062283292 | 3300005764 | Tropical Forest Soil | MPSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVWANLR |
| Ga0066903_1063964021 | 3300005764 | Tropical Forest Soil | MPSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVWANLRGVDS |
| Ga0068858_1001546952 | 3300005842 | Switchgrass Rhizosphere | MPPTSDVHLISGSDLQRFASALFQALGVAGPMADEWARSLVWANLRGV |
| Ga0070717_107773191 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSKTDLCVIASADLQRFASHLFVAAGVAPAMADEWA |
| Ga0075425_1028389532 | 3300006854 | Populus Rhizosphere | MPPTSDVHLISGSDLQRFASALFQALGVAGPMADEWARSLVWANL |
| Ga0068865_1012917072 | 3300006881 | Miscanthus Rhizosphere | MPPTSDDVHLISGSDLQRFASALFQALGVAGPMADEWARSLVWANLRGVDS |
| Ga0099829_101793663 | 3300009038 | Vadose Zone Soil | MPPKSDLHVIQSSDLQRFASALFQASGVARPMADEWAKSLVWANLRGVD |
| Ga0099827_102104262 | 3300009090 | Vadose Zone Soil | MPPKSELHVIQSHDLERFASALFQPLGVAPVMEKTWLML* |
| Ga0126374_104582302 | 3300009792 | Tropical Forest Soil | MSSRSELHVIQAADLERFASALFQAAGVAEAMADEWARSLVWANLRG |
| Ga0126380_115596941 | 3300010043 | Tropical Forest Soil | MPAKSELHLVRGSDLERFASALFQATGVARAMADDWAKSLVWANLRGT |
| Ga0126384_103682152 | 3300010046 | Tropical Forest Soil | MPAKAEMHVIAAAELERFASALLQALKVARPMADEWAKSL |
| Ga0126384_105860081 | 3300010046 | Tropical Forest Soil | MPSDTKLHVIPSTDLQRFARALFQAAGVAPPMADEWAKSLVW |
| Ga0126384_109737291 | 3300010046 | Tropical Forest Soil | LKTESHLILSADLQRFAGALFEAAGVAPAMADEWAKSLVWANLR |
| Ga0126373_114069651 | 3300010048 | Tropical Forest Soil | MPSKTEVHVIPSADLQRFASALFHAAGVAPPMADEWAKSLVW |
| Ga0134071_105255882 | 3300010336 | Grasslands Soil | MKPKTELHVISSADLHRFASALFATAGVVPAMAEE |
| Ga0126376_112134911 | 3300010359 | Tropical Forest Soil | MPSDSKLQVIPSADLQRFASALFHAAGVAPPMADEWAKSLVWANLRGV |
| Ga0126372_102888741 | 3300010360 | Tropical Forest Soil | MSSRSELHVVQASDLERFASALFQAAGVAEAMADEWARSLVWANLRG |
| Ga0126379_108536481 | 3300010366 | Tropical Forest Soil | MPAKAEMHVIAAAELERFASALLQALKVARPMADEWAKS |
| Ga0126381_1012092861 | 3300010376 | Tropical Forest Soil | MPSKLEVHVISSADLQRFAGALFQAAGVAPAMADQWAKSLVWANLRG |
| Ga0126381_1023296082 | 3300010376 | Tropical Forest Soil | MPSDSKLHVIPSADLQRFASALFAAAGVAPPMADE |
| Ga0126383_106227492 | 3300010398 | Tropical Forest Soil | MSSRSALHVIQAADLERFASALFQAAGVTEAMADEWAR |
| Ga0134122_125675442 | 3300010400 | Terrestrial Soil | MPPTSELHLIAGSDLQRFASALFQALDVAGPMADE |
| Ga0137383_108082001 | 3300012199 | Vadose Zone Soil | MKPKTELHVISSADLHHFASALFAAAGVVPAMAEEWAKSLVWANL |
| Ga0137399_112550122 | 3300012203 | Vadose Zone Soil | MSSKSDLHVIQSSDLQRFASALFQASRVAQPMADEWAESLVWANLR |
| Ga0137381_117795422 | 3300012207 | Vadose Zone Soil | MPSKSESHVISSADLERFASALFQAAGVAPSMADEWAKSLVWAN |
| Ga0137377_106919802 | 3300012211 | Vadose Zone Soil | MPSKSESHVISSADLERFASALFQAAGVAPSMADEW |
| Ga0137360_115137732 | 3300012361 | Vadose Zone Soil | MPSDSKLHVIASADLQRFASALFAAAGVAPPMADEWAKSL |
| Ga0137361_100857713 | 3300012362 | Vadose Zone Soil | MPSDTKLHVIPSADLQHFARALFQAAGVAPAMADQWAKSLVWANL |
| Ga0137390_103683191 | 3300012363 | Vadose Zone Soil | MSAKSELHVIQSADLERFASALFEGAGVARPLAEEWAKSLIWANLR |
| Ga0157291_103313202 | 3300012902 | Soil | MPPTSELHLIAGSDLQRFASALFQALGVAGPMADEWAKSLVWAN |
| Ga0157295_103851822 | 3300012906 | Soil | MPSTSDLQLISGSDLQRFASALFQALGVAGPMADEWAR |
| Ga0126375_113202212 | 3300012948 | Tropical Forest Soil | MSSKLELHVIPTADLQHFARALFEAAGVAPPMADQWAKSLVWANLR |
| Ga0164300_106474301 | 3300012951 | Soil | MPSNTQSQVISSADRGRFAPPLFVAAGVAPAMAGAWAKSPVWADLRGGVDSHGVL |
| Ga0164298_103691681 | 3300012955 | Soil | MPPTSELHLIAGSDLQRFASALFQALGVAGPMADEWAKSLVWANLRGV |
| Ga0126369_133160141 | 3300012971 | Tropical Forest Soil | LQVTEMPSDTKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVWANLR |
| Ga0163162_120635032 | 3300013306 | Switchgrass Rhizosphere | MSPTSDVHLISGSDLQRFASALFQALGVAGPMADEWARSLVWANLRGVDS |
| Ga0157372_132027722 | 3300013307 | Corn Rhizosphere | MPPTSELHLIAGSDLQRFASALFQALGVAGPMADEWAKSLVWANLRGVD |
| Ga0157379_116421552 | 3300014968 | Switchgrass Rhizosphere | MSAKNELHVISGDDLRRFSSALFQARGVAPAMADEWATSLVWANLRGV |
| Ga0182033_112150662 | 3300016319 | Soil | LKTESHVILSADLQCFAGALFVAAGVAPAMADEWAKSLVW |
| Ga0182035_106828161 | 3300016341 | Soil | LKTESHVILSADLQCFAGALFVAAGVAPAMADEWAKSLVWANLRG |
| Ga0182035_119409571 | 3300016341 | Soil | MPSKRELHVIPSVDLQHFARALFEAAGVAPPMADQWAKSLVWANLR |
| Ga0182032_106757291 | 3300016357 | Soil | MPLKTESHVILSADLQCFAGALFVAAGVAPAMADEWAKSLVWANL |
| Ga0182034_103730971 | 3300016371 | Soil | MPPKLELHVIPSADLQHFARALFEAAGVAPPMADQWAKSL |
| Ga0182037_106204482 | 3300016404 | Soil | MPLKTESHVILSTGLQRFAGALFVAAGVAPAMADEWAKSLVWANLR |
| Ga0182037_113304062 | 3300016404 | Soil | MSSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVW |
| Ga0182039_114897231 | 3300016422 | Soil | MPLKTDLHIIQSDALERFASALFRALGVAPDMGDEWARSLVWANL |
| Ga0163161_112549701 | 3300017792 | Switchgrass Rhizosphere | MPPTSDDVHLISGSDLQRFASALFQALGVAGPMADEWARSLVWANLRGV |
| Ga0184605_100630442 | 3300018027 | Groundwater Sediment | MPPKSELHVIPSSDLQGFASALFQALGVAGPMADEWA |
| Ga0137408_11042921 | 3300019789 | Vadose Zone Soil | MPSKSESHVVISSADLERFASALFQAAGVAPSMADEWAKSL |
| Ga0193701_10039013 | 3300019875 | Soil | MPPKSELHVIPSSDLQGFASALFQALGVAGPMADEWAKSLVWA |
| Ga0193727_11016082 | 3300019886 | Soil | MPPKSELHVIPSSDLQGFASALFQASGVAGPMADEWAKSLVWANLRGVDS |
| Ga0210400_115236911 | 3300021170 | Soil | MPSDSKLHVIASADLQRFASSLFAAAGVAPPMADEWAKSLVW |
| Ga0193698_10217911 | 3300021968 | Soil | MPPKSELHVIPSSDLQGFASALFQASGVAGPMADEWAKSLVWANL |
| Ga0207656_103552752 | 3300025321 | Corn Rhizosphere | MPPTSDDVHLISGSDLQRFASALFQALGVAGPMADEWARSLVWANLRG |
| Ga0207692_107727282 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSDSKLHVIASADLQRFASSLFAAAGVAPPMADEWAKSLVWA |
| Ga0207693_111639641 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPTSELHLIAGSDLQRFASALFQALGVAGPMADEWAKSLVWANLRGVDS |
| Ga0207686_106625362 | 3300025934 | Miscanthus Rhizosphere | MPPTSNDVHLISGSDLQRFASGLFQALGVAGPMADEWARSLVWA |
| Ga0207651_109410842 | 3300025960 | Switchgrass Rhizosphere | MPPTSDDVHLISGSDLQRFASALFQALGVAGPMADE |
| Ga0207658_107905791 | 3300025986 | Switchgrass Rhizosphere | MPPTSELHLIAGSDLQRFASALFQALGVAGPMADEWAKSLVWANLRG |
| Ga0209283_108446632 | 3300027875 | Vadose Zone Soil | MSAKSELHVIQSADLERFASALFEGAGVARPLAEEWAKSLIWANLRG |
| Ga0307305_104014281 | 3300028807 | Soil | MPPKSELHVIPSSDLQGFASALFQALGVAGPMADEWAKSLVWANLRGVDS |
| Ga0318492_103198751 | 3300031748 | Soil | MPPKLELHVIPSADLQHFARALFEAAGVAPPMADQWAKSLVWANLR |
| Ga0318494_108431962 | 3300031751 | Soil | MPSDTKLHVIPSTDLQRFARALFQAAGVAPPMADEWAKSLVWAN |
| Ga0318537_100448783 | 3300031763 | Soil | MPSDSKLHVIPSADLQRFASALLAAAGVAPPMADEWAKSLVWANL |
| Ga0318546_105320262 | 3300031771 | Soil | MPSKLEVHVISSADLQRFAGALFQAAGVAPAMADQWAK |
| Ga0318497_103545463 | 3300031805 | Soil | MPLKTESHVILSTGLQRFAGALFVAAGVAPAMADEWAKSLVWANLRG |
| Ga0318495_104464341 | 3300031860 | Soil | MPPKLELHVIPSADLQHFARALFEAAGVAPPMADQWAKSLVWANLRGVDS |
| Ga0306925_119333291 | 3300031890 | Soil | MPSDTKLHVIPSTDLQRFASALFHAAGVAPPMADEWAKSLVWANLRGVDS |
| Ga0318522_100012956 | 3300031894 | Soil | MPSDSKLHVIPSADLQRFASALLAAAGVAPPMADEWAKSLVWANLRGVDS |
| Ga0306921_105702203 | 3300031912 | Soil | LKTKSHVIPSADLQRFAGALFVAAGVAPAMADEWAKSLVWAN |
| Ga0310916_106394981 | 3300031942 | Soil | MPSDSKLHVIASADLQRFASALLAAAGVAPPMADEWAKSLVWAN |
| Ga0318507_102896781 | 3300032025 | Soil | LKTESHVILSADLQCFAGALFVAAGVAPAMADEWAKSLVWANLRGVD |
| Ga0318507_103590332 | 3300032025 | Soil | MPSKNESHVIASADLERFASALFAAAGVAPAMADEWAKSLVWANLRGV |
| Ga0318575_100440124 | 3300032055 | Soil | MPLKTESHVILSTGLQCFAGALFVAAGVAPAMADEWAKSLVWANLRGVD |
| Ga0318505_101388302 | 3300032060 | Soil | MPSDSKLHVIPSADLQRFASALFAAAGVAPPMADEWAKSLVWANLRGVD |
| Ga0318504_100367751 | 3300032063 | Soil | MPSDTKLHVIPSTDLQRFARALFQAAGVAPPMADEWAN |
| Ga0318513_105283041 | 3300032065 | Soil | MPSDSKLHVIPNADLQRFASALFAAAGVAPPMADEWA |
| Ga0318524_103394472 | 3300032067 | Soil | MPPKLELHVIPSADLQHFARALFEAAGVAPPMADQWAKSLVWANL |
| Ga0307471_1006971141 | 3300032180 | Hardwood Forest Soil | MTSKTELHVISGADLQRFASAFFAAAGVAQAMAEEWARSLVW |
| ⦗Top⦘ |