


| Basic Information | |
|---|---|
| Family ID | F100479 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGVETKKMANSIAAAGGNFGDQLKSWPERIKTFYNDVRT |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.04 % |
| % of genes near scaffold ends (potentially truncated) | 97.06 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.608 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.628 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.569 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00471 | Ribosomal_L33 | 33.33 |
| PF03144 | GTP_EFTU_D2 | 21.57 |
| PF03143 | GTP_EFTU_D3 | 18.63 |
| PF03946 | Ribosomal_L11_N | 0.98 |
| PF14492 | EFG_III | 0.98 |
| PF02357 | NusG | 0.98 |
| PF00584 | SecE | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 33.33 |
| COG0080 | Ribosomal protein L11 | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.98 |
| COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
| COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.61 % |
| Unclassified | root | N/A | 30.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101311577 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300004474|Ga0068968_1500983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 604 | Open in IMG/M |
| 3300004607|Ga0068948_1327407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 679 | Open in IMG/M |
| 3300004614|Ga0068956_1398157 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005336|Ga0070680_100917876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 756 | Open in IMG/M |
| 3300005445|Ga0070708_100084003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2888 | Open in IMG/M |
| 3300005450|Ga0066682_10891632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 531 | Open in IMG/M |
| 3300005534|Ga0070735_10398262 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005568|Ga0066703_10265153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1041 | Open in IMG/M |
| 3300006162|Ga0075030_101445259 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300007076|Ga0075435_100216041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1627 | Open in IMG/M |
| 3300009521|Ga0116222_1087536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1342 | Open in IMG/M |
| 3300009624|Ga0116105_1082024 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009792|Ga0126374_10761382 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010359|Ga0126376_12164040 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010376|Ga0126381_100739479 | Not Available | 1409 | Open in IMG/M |
| 3300010399|Ga0134127_11090177 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300011054|Ga0138523_1102550 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300011120|Ga0150983_11157048 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300011271|Ga0137393_11029798 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012083|Ga0154000_1109393 | Not Available | 568 | Open in IMG/M |
| 3300012208|Ga0137376_11702524 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012356|Ga0137371_10736568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300012363|Ga0137390_10672248 | Not Available | 999 | Open in IMG/M |
| 3300012378|Ga0134025_1087200 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012513|Ga0157326_1081725 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012925|Ga0137419_10880806 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012927|Ga0137416_11688952 | Not Available | 577 | Open in IMG/M |
| 3300012955|Ga0164298_10178831 | Not Available | 1220 | Open in IMG/M |
| 3300012976|Ga0134076_10282821 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012989|Ga0164305_11554667 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012989|Ga0164305_11582942 | Not Available | 584 | Open in IMG/M |
| 3300013296|Ga0157374_10601385 | Not Available | 1110 | Open in IMG/M |
| 3300013296|Ga0157374_10650975 | Not Available | 1065 | Open in IMG/M |
| 3300013308|Ga0157375_11888086 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300014493|Ga0182016_10407980 | Not Available | 803 | Open in IMG/M |
| 3300015054|Ga0137420_1495457 | Not Available | 3425 | Open in IMG/M |
| 3300016319|Ga0182033_10511397 | Not Available | 1033 | Open in IMG/M |
| 3300017822|Ga0187802_10117608 | Not Available | 1006 | Open in IMG/M |
| 3300017934|Ga0187803_10181141 | Not Available | 829 | Open in IMG/M |
| 3300018047|Ga0187859_10483744 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018047|Ga0187859_10878949 | Not Available | 516 | Open in IMG/M |
| 3300019242|Ga0181502_1203354 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300019787|Ga0182031_1266726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1835 | Open in IMG/M |
| 3300019887|Ga0193729_1275057 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300020579|Ga0210407_11223457 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300020582|Ga0210395_10036922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3583 | Open in IMG/M |
| 3300021088|Ga0210404_10235189 | Not Available | 992 | Open in IMG/M |
| 3300021404|Ga0210389_10833912 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300021406|Ga0210386_10981267 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300021407|Ga0210383_10133205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2106 | Open in IMG/M |
| 3300021432|Ga0210384_11055388 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300021478|Ga0210402_11723919 | Not Available | 553 | Open in IMG/M |
| 3300021559|Ga0210409_11209831 | Not Available | 631 | Open in IMG/M |
| 3300022507|Ga0222729_1009284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1004 | Open in IMG/M |
| 3300022531|Ga0242660_1202945 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300022532|Ga0242655_10207800 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300022711|Ga0242674_1006761 | Not Available | 1115 | Open in IMG/M |
| 3300022716|Ga0242673_1083765 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300022716|Ga0242673_1090510 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300022726|Ga0242654_10138077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 803 | Open in IMG/M |
| 3300023255|Ga0224547_1024208 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300023551|Ga0247546_106093 | Not Available | 516 | Open in IMG/M |
| 3300024179|Ga0247695_1013396 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300025899|Ga0207642_10472773 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300025916|Ga0207663_10452611 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300025945|Ga0207679_11899417 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026078|Ga0207702_10919190 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300026142|Ga0207698_10361849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1374 | Open in IMG/M |
| 3300026318|Ga0209471_1219071 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300026329|Ga0209375_1058220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1888 | Open in IMG/M |
| 3300026335|Ga0209804_1299481 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300026530|Ga0209807_1013112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4080 | Open in IMG/M |
| 3300026548|Ga0209161_10033615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3510 | Open in IMG/M |
| 3300026550|Ga0209474_10339166 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300026786|Ga0207497_105815 | Not Available | 509 | Open in IMG/M |
| 3300026847|Ga0207802_1020007 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027029|Ga0208731_1037473 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300027035|Ga0207776_1023705 | Not Available | 809 | Open in IMG/M |
| 3300027737|Ga0209038_10062569 | Not Available | 1115 | Open in IMG/M |
| 3300027867|Ga0209167_10009916 | All Organisms → cellular organisms → Bacteria | 4532 | Open in IMG/M |
| 3300027869|Ga0209579_10040787 | Not Available | 2497 | Open in IMG/M |
| 3300027879|Ga0209169_10134089 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300027908|Ga0209006_11417238 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027986|Ga0209168_10155937 | Not Available | 1156 | Open in IMG/M |
| 3300029908|Ga0311341_10507910 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300029953|Ga0311343_10467058 | Not Available | 1134 | Open in IMG/M |
| 3300030007|Ga0311338_10403554 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → Blastopirellula marina → Blastopirellula marina DSM 3645 | 1466 | Open in IMG/M |
| 3300030524|Ga0311357_11575498 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300030588|Ga0210283_1657780 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300030617|Ga0311356_11213177 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300030688|Ga0311345_10206584 | Not Available | 1985 | Open in IMG/M |
| 3300030963|Ga0265768_117178 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031708|Ga0310686_108956116 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031788|Ga0302319_10615642 | Not Available | 1125 | Open in IMG/M |
| 3300031942|Ga0310916_10937937 | Not Available | 724 | Open in IMG/M |
| 3300031956|Ga0316032_106407 | Not Available | 582 | Open in IMG/M |
| 3300032174|Ga0307470_11316523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300032892|Ga0335081_10813054 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300032893|Ga0335069_11778770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300032955|Ga0335076_10741543 | Not Available | 864 | Open in IMG/M |
| 3300033405|Ga0326727_10450808 | Not Available | 1147 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004607 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004614 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011054 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012083 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC084 MetaG | Host-Associated | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026786 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030588 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031956 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1013115771 | 3300002245 | Forest Soil | MGVETKKKMANSIASAGGNFGDQIKSWPERVKTFYNDVRTETRKVT |
| Ga0068968_15009831 | 3300004474 | Peatlands Soil | MPERARRSMGVETKKMANSIASAGENFGDRLKSWPERVKTFYNDV |
| Ga0068948_13274071 | 3300004607 | Peatlands Soil | MGVETKKMANSIASAGENFGDRLKSWPERIKSFYNDVRTEMRKV |
| Ga0068956_13981574 | 3300004614 | Peatlands Soil | MSVETKKMANLAAAGGNFGDQIKSWPERIRTFYNDVRTEMRKV |
| Ga0070680_1009178762 | 3300005336 | Corn Rhizosphere | MGVETKKMADSLVAAGDNWGDRIKSWPERIKAFYNDVRTEMKK |
| Ga0070708_1000840031 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAGTKKMANTVAAANDDSWGGKMKSLPERIKSFYNDVRTEMRKV |
| Ga0066682_108916323 | 3300005450 | Soil | MGVGTGTKKMANSIAAAGDEGFGGIKSWPERIKSFYSDVRTEMRKV |
| Ga0070735_103982621 | 3300005534 | Surface Soil | MSVETKKMANSIAVGSFGERLKSWPEKVRSFYNEV |
| Ga0066703_102651531 | 3300005568 | Soil | MGVETKKMANTLAAAGDFGDRIRSWPERIKGFYSDVR |
| Ga0075030_1014452591 | 3300006162 | Watersheds | MAVETKKMSNLAAMGGNFGDQIKAWPERIRAFYNDVRSEM |
| Ga0075435_1002160411 | 3300007076 | Populus Rhizosphere | MANTVAAANDDSWGGKMKSLPERIKSFYNDVRTEMRKV |
| Ga0116222_10875361 | 3300009521 | Peatlands Soil | MGVETKKMANSIAAAGGSFGDRIKSWPEKIRTFYNDVRTETRKVT |
| Ga0116105_10820241 | 3300009624 | Peatland | MGVETKKMANSMASAGGNFAEQIKSWPERVKTFYNDVRTE |
| Ga0126374_107613821 | 3300009792 | Tropical Forest Soil | MSVETKKMANSIAATGGPFLDRIKSWLDKVRGFYNDVRTEMRKVT |
| Ga0126376_121640403 | 3300010359 | Tropical Forest Soil | MSVETRKMATSIAEGGGNFGERMKSWPDKIKTFYNDVRMEMKKV |
| Ga0126381_1007394793 | 3300010376 | Tropical Forest Soil | MSIETKKMSNSIAATGGNFGGFKSWPEKVRTFYNEVRNEMRK |
| Ga0134127_110901771 | 3300010399 | Terrestrial Soil | MGAGTKKMANSIAAAGDDSFGGKVKSLPERVKVFYNDVRT |
| Ga0138523_11025503 | 3300011054 | Peatlands Soil | MAVETKKMANLAAASGNFGDQIKSWPERIRTFYNDVRTEMR |
| Ga0150983_111570481 | 3300011120 | Forest Soil | MAVETKKMANLAAAGGSFGDQIKSWPDRIKVFYNDVRSEMRK |
| Ga0137393_110297984 | 3300011271 | Vadose Zone Soil | MGVETKKMASSSAAAGGNFGDQIKSWPQRVKSFYN |
| Ga0154000_11093933 | 3300012083 | Attine Ant Fungus Gardens | LEKVEERQYMGVETKKMSNSIASAGDFGDRLKAWPERAKSFYNDVRTE |
| Ga0137376_117025242 | 3300012208 | Vadose Zone Soil | MGVETKKMANTLAAAGDFGDRIRSWPERIKGFYSD |
| Ga0137371_107365681 | 3300012356 | Vadose Zone Soil | MGVGTGTKKMANSIAAAGEGGFGGIKSWPERIKSFYNDVRTEMRKVT |
| Ga0137390_106722483 | 3300012363 | Vadose Zone Soil | MGVETKKMANSIASASENFGGRLKSWPERIKSFYNDV |
| Ga0134025_10872003 | 3300012378 | Grasslands Soil | MAVGTGTKKMANSIATAGESGFGGIKSWPERIKSFYNDVRTEMR |
| Ga0157326_10817251 | 3300012513 | Arabidopsis Rhizosphere | MSVETKKMANSIVAAGGSFGERLKSWPDKVKTFYNDVRSEMRKV |
| Ga0137419_108808063 | 3300012925 | Vadose Zone Soil | MGVDTKKMANSITAAGDNFGDRMKSWPQRVKTFYN |
| Ga0137416_116889523 | 3300012927 | Vadose Zone Soil | MGVETKKMANSIAAAGENFGGRIKSWPERVRTFYND |
| Ga0164298_101788313 | 3300012955 | Soil | MSVETKKMANSIVTASSSFGDRVKAWPERIRTFYNDVRTETRKVTA |
| Ga0134076_102828213 | 3300012976 | Grasslands Soil | MAVGTKKMAKSIAAAGESGFGGIRSWPERIKAFYNDV |
| Ga0164305_115546671 | 3300012989 | Soil | MSVETKKMANLAAAGGSFGDQIKSWPDRIKVFYNDVRSE |
| Ga0164305_115829422 | 3300012989 | Soil | MGVETKKMGNSIVAAGGSFGDRLKSWPERIKTFYNDVRTEMK* |
| Ga0157374_106013853 | 3300013296 | Miscanthus Rhizosphere | MGVETKKMADSIVAAGDNWGDRIKSWPDRIKSFYNDV |
| Ga0157374_106509753 | 3300013296 | Miscanthus Rhizosphere | MAVETKKMANTLASAGGSFGDRIKSWPERTMSFYNAVPTEM |
| Ga0157375_118880861 | 3300013308 | Miscanthus Rhizosphere | MGVEAKKMANSLAEAGDNLGDRLKSWPLRLKTFYNDVRTEM |
| Ga0182016_104079804 | 3300014493 | Bog | MGVETKKMANSIATTSGDFGNRLRSWPDRIKTFYG |
| Ga0137420_14954573 | 3300015054 | Vadose Zone Soil | MGVEAKKMASSIASAGDSFGDRIKSWPERIKSFTTMCARR* |
| Ga0182033_105113974 | 3300016319 | Soil | VIAVETKKMSNALTAAGGNWMDRIKTWPEQIKTFYNDVRTEMK |
| Ga0187802_101176084 | 3300017822 | Freshwater Sediment | MAVETKKMSNLATIGGNFGDQIKAWPERIRAFYNDVRSEM |
| Ga0187803_101811411 | 3300017934 | Freshwater Sediment | MGVKTEKMANSIAAAGDNFGGRLKAWPERIKTFYN |
| Ga0187859_104837441 | 3300018047 | Peatland | MGVETKKMANSIATASENFGDRIKSWPERIKSFYNDVRTE |
| Ga0187859_108789493 | 3300018047 | Peatland | MGVETKKKMANSLAAGGENFGDRLKSWPERIKTFYNDVRTETRKVT |
| Ga0181502_12033541 | 3300019242 | Peatland | MAVETKSKMANSLTGGNFGEQVKAWPERIKTFYNDV |
| Ga0182031_12667262 | 3300019787 | Bog | MGVETKKMANSIATTGGDFGDRLRSWPERIKSFYHDVRTEMKK |
| Ga0193729_12750571 | 3300019887 | Soil | MAVETKKMANSIAAAGGNFGDRLKSFPERIKSFYSDVRTE |
| Ga0210407_112234571 | 3300020579 | Soil | MSVETKKMANSIVAAGGSFGDQIKSWPERIKTFYNDVR |
| Ga0210395_1003692212 | 3300020582 | Soil | MGVETKKMANSIATAGENFGDRLKSWPERVKSFYNDVR |
| Ga0210404_102351891 | 3300021088 | Soil | MAVETKKMANLAEMGGNFGDQIKSWPERIKAFYND |
| Ga0210389_108339123 | 3300021404 | Soil | MGVETKKMANSIAAAGDNFGDRLKAWPERVKVFYN |
| Ga0210386_109812674 | 3300021406 | Soil | MAVETKKMANLAAAGGNFGEQMKAWPERIRTFYSDIRSE |
| Ga0210383_101332051 | 3300021407 | Soil | MGVETKKMANSMASAGGSFGAQIRSWPERVKTFYNDVRTE |
| Ga0210384_110553881 | 3300021432 | Soil | MAVETKKMANLAAAGGNFGDQIKSWPERVKTFYNDVRGEMRKVT |
| Ga0210402_117239191 | 3300021478 | Soil | MGVETKKMGNLIAAAGGSFGDRLKSWPERVKTFYNDVRTEM |
| Ga0210409_112098313 | 3300021559 | Soil | MGVETKKMGNLIAAAGGSFGDRLKSWPERVKTFYNDVRTEMK |
| Ga0222729_10092844 | 3300022507 | Soil | MANSIASAGENFGDRLKSWPERIKSFYNDVRTEMRKVTA |
| Ga0242660_12029452 | 3300022531 | Soil | MGVETKKMANSITAAGDFGDRLKAWPERAKSFYNDVRTEMRKV |
| Ga0242655_102078002 | 3300022532 | Soil | MAVETKKMANLAPFGGIVDRVKSWPEQVRTFYNDVRTEMRKV |
| Ga0242674_10067613 | 3300022711 | Soil | MANSITTAGSNFGDQIKSWPERVRTFYNDVRTETRKV |
| Ga0242673_10837654 | 3300022716 | Soil | MAVETKKKMANSIVTAGENFGDRLKSWPERIKSFYNDVR |
| Ga0242673_10905103 | 3300022716 | Soil | MAVETKKKMANSIATAGENFGDRLKSWPERIKTFYNDV |
| Ga0242654_101380771 | 3300022726 | Soil | MGVETKKMGNLIAAAGGSFGDRLKSWPERVKTFYNDVR |
| Ga0224547_10242081 | 3300023255 | Soil | MGVETKKMANSIATAGENFGDRLKSWPERIKTFYNDVRTETRKV |
| Ga0247546_1060931 | 3300023551 | Soil | MGVETKKKMANSIASAGGNFGDQIKSWPERVKTFYNDVR |
| Ga0247695_10133961 | 3300024179 | Soil | MGVEAKKMSNSIATAGENFGDKLKSWPERTKTFYN |
| Ga0207642_104727731 | 3300025899 | Miscanthus Rhizosphere | MANSLAAAGDNFSDRVKSWPQRVKAFYNDVRTEMRKVT |
| Ga0207663_104526111 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MANTVAAANDDSWGGKMKSLPERIKSFYNDVRTEMRK |
| Ga0207679_118994171 | 3300025945 | Corn Rhizosphere | MAVGTKKMANTAAAANDDSFGGKVKSIPERIKAFYNDV |
| Ga0207702_109191903 | 3300026078 | Corn Rhizosphere | MSVETKKMANSIVTASSSFGDRVKAWPERIRSFYNDVRTETRKVTA |
| Ga0207698_103618493 | 3300026142 | Corn Rhizosphere | MGVETKKMADSLVAAGDNWGDRIKSWPERIKAFYNDVRTEMKKVT |
| Ga0209471_12190711 | 3300026318 | Soil | MALGAGTKKMANSIAAADDSSFGGRIKSLPERVKAFYNDVRT |
| Ga0209375_10582201 | 3300026329 | Soil | MGVETKKMANSLAAVGDFGGRLKSWPERIRSFYND |
| Ga0209804_12994811 | 3300026335 | Soil | MSVETKKMANSIVTASSSFGDRVKAWPERIRSFYNDVRTET |
| Ga0209807_10131125 | 3300026530 | Soil | MAVGTKKMANSIAAAGEEGFGRIKSWPERIKSFYNDIRTEM |
| Ga0209161_100336151 | 3300026548 | Soil | MGVETKKMANTLAAAGDFGDRIKSWPERIKTFYNDVRTEMKK |
| Ga0209474_103391661 | 3300026550 | Soil | MAVGTKKMANSIAAAGEEGFGRIKSWPERIKSFYNDIRTEMRKVTS |
| Ga0207497_1058151 | 3300026786 | Soil | MSVETKKMANSIVTASSSFGDRVKAWPERIRTFYNDV |
| Ga0207802_10200071 | 3300026847 | Tropical Forest Soil | MGVEAKKMASTLASAGDNFGDRLKSWPERIKGFYGDV |
| Ga0208731_10374731 | 3300027029 | Forest Soil | MANSIATVGASFGERLKSWPERVKSFYNDVRTEMRK |
| Ga0207776_10237051 | 3300027035 | Tropical Forest Soil | MSVETKKMANSIAASGGDFLDRVKSWPDKIKGFYNDVRTEM |
| Ga0209038_100625691 | 3300027737 | Bog Forest Soil | MGVETKKMANSIASVGENFGDRLKSWPERVKTFYND |
| Ga0209167_100099161 | 3300027867 | Surface Soil | MAVETKKMANLAEMGGNFGDQIKSWPERIKAFYNDVRTE |
| Ga0209579_100407875 | 3300027869 | Surface Soil | MSVETKKMSNSLAAAGGNFGDQVKALPERIRTFYNDVRNEMRKV |
| Ga0209169_101340891 | 3300027879 | Soil | MSVETKKMSNSIVAAGGNFGDQIKAWPERIKTFYNDVRSEMRKVTAPSW |
| Ga0209006_114172381 | 3300027908 | Forest Soil | MGVETKKKMANSIASAGGNFGDQIKSWPERVKTFYNDVRTETRKVTA |
| Ga0209168_101559371 | 3300027986 | Surface Soil | MSVETKKMANSIAVGSFGERLKSWPEKVRSFYNEVRT |
| Ga0311341_105079103 | 3300029908 | Bog | MGVETKKMANSIATTGGDFGDRLRSWPERIKSFYHDVRTEM |
| Ga0311343_104670584 | 3300029953 | Bog | MGVETKKMANSIAAAGGNFGDQLKSWPERIKTFYNDVRT |
| Ga0311338_104035544 | 3300030007 | Palsa | MGVETKKMSNSIAAHGDSFGDRLKSWPERIRNFYHD |
| Ga0311357_115754981 | 3300030524 | Palsa | MGVETKKMANSIAAAGGNFGDQIKSWPERVRTFYNDVRTEM |
| Ga0210283_16577801 | 3300030588 | Soil | MANSIVTASGSFADRLKSWPERARSFYNDVRSEMRK |
| Ga0311356_112131774 | 3300030617 | Palsa | MGVETKKMANSIAAAGGNFGDQIKSWPERVRTFYND |
| Ga0311345_102065845 | 3300030688 | Bog | MAVESKKMANSITTAGANFGDQIKSWPERIKTFYNDVR |
| Ga0265768_1171783 | 3300030963 | Soil | MAVETKKMANLASAGGNFGEQMKAWPERIRTFYNDIRSEMRKVTS |
| Ga0310686_1089561161 | 3300031708 | Soil | MGVETKKMANSIATAGGDFGDRLKSWPERAKSFYNDV |
| Ga0302319_106156423 | 3300031788 | Bog | MGVETKKMANSIATTSGDFGNRLRSWPDRIKTFYGDVRTEM |
| Ga0310916_109379371 | 3300031942 | Soil | MSVETKKMANSIAAAGDNFFDRVKSWPDKIKGFYNDVRTEMRKVTAP |
| Ga0316032_1064071 | 3300031956 | Soil | MGVETKKMANSIASAGENFGDRLKSWPERIKSFYNDVRTEM |
| Ga0307470_113165231 | 3300032174 | Hardwood Forest Soil | MANSLAAAGGNFGDQVKAWPERIRTFYNDVRNEMRKVTAPSF |
| Ga0335081_108130541 | 3300032892 | Soil | MGVETKRMAKSIAAAAGDEGFGRLKSWPERVKTFYNDVRTEMR |
| Ga0335069_117787701 | 3300032893 | Soil | MAIETKKMASTITAAGDNLGDKLKSWPLRVKTFYNDVRTETKK |
| Ga0335076_107415434 | 3300032955 | Soil | MDEAGKRMGVETKKMADSIATAGENLGDRIKAWPER |
| Ga0326727_104508083 | 3300033405 | Peat Soil | MSVQTKERSNSIMAAGGSFGDQIKSWPERIKTFYNDV |
| ⦗Top⦘ |