


| Basic Information | |
|---|---|
| Family ID | F100462 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 37 residues |
| Representative Sequence | NGIKFAFPTVQVAGEGEAATAAVAQRALELTQPAAA |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 96.08 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.216 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.039 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.56% β-sheet: 0.00% Coil/Unstructured: 73.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13458 | Peripla_BP_6 | 6.86 |
| PF01687 | Flavokinase | 6.86 |
| PF06574 | FAD_syn | 6.86 |
| PF08448 | PAS_4 | 4.90 |
| PF00691 | OmpA | 1.96 |
| PF12833 | HTH_18 | 1.96 |
| PF00106 | adh_short | 0.98 |
| PF01152 | Bac_globin | 0.98 |
| PF06186 | DUF992 | 0.98 |
| PF06411 | HdeA | 0.98 |
| PF05598 | DUF772 | 0.98 |
| PF12625 | Arabinose_bd | 0.98 |
| PF02470 | MlaD | 0.98 |
| PF03060 | NMO | 0.98 |
| PF06445 | GyrI-like | 0.98 |
| PF13701 | DDE_Tnp_1_4 | 0.98 |
| PF14559 | TPR_19 | 0.98 |
| PF03992 | ABM | 0.98 |
| PF14850 | Pro_dh-DNA_bdg | 0.98 |
| PF00239 | Resolvase | 0.98 |
| PF07642 | BBP2 | 0.98 |
| PF12762 | DDE_Tnp_IS1595 | 0.98 |
| PF09865 | DUF2092 | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF09351 | DUF1993 | 0.98 |
| PF10009 | DUF2252 | 0.98 |
| PF00857 | Isochorismatase | 0.98 |
| PF00884 | Sulfatase | 0.98 |
| PF00083 | Sugar_tr | 0.98 |
| PF01968 | Hydantoinase_A | 0.98 |
| PF01425 | Amidase | 0.98 |
| PF12806 | Acyl-CoA_dh_C | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 13.73 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.98 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.98 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.98 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.98 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.98 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.98 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.20 % |
| Unclassified | root | N/A | 9.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01CEOVZ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300004080|Ga0062385_10990216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300004635|Ga0062388_101174930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300005367|Ga0070667_100159406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1986 | Open in IMG/M |
| 3300005435|Ga0070714_100449668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1224 | Open in IMG/M |
| 3300005764|Ga0066903_103995749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300005921|Ga0070766_11070779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300006028|Ga0070717_11493394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 613 | Open in IMG/M |
| 3300007255|Ga0099791_10363716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300009012|Ga0066710_101659297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 975 | Open in IMG/M |
| 3300009137|Ga0066709_103724954 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010359|Ga0126376_10615519 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300010360|Ga0126372_12754248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300010361|Ga0126378_11312081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300010361|Ga0126378_11663980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300010361|Ga0126378_11974041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300010361|Ga0126378_13230133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300010376|Ga0126381_101266373 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010376|Ga0126381_101464885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
| 3300010376|Ga0126381_103885999 | Not Available | 583 | Open in IMG/M |
| 3300010398|Ga0126383_13559438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300011120|Ga0150983_12968021 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012208|Ga0137376_10771468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300012208|Ga0137376_11079294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300012957|Ga0164303_10794034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300016270|Ga0182036_10504851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300016357|Ga0182032_10257109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1360 | Open in IMG/M |
| 3300016371|Ga0182034_10060428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2551 | Open in IMG/M |
| 3300016404|Ga0182037_12058332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300017943|Ga0187819_10191346 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300018431|Ga0066655_11357783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300018468|Ga0066662_11502086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300020579|Ga0210407_10978560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 646 | Open in IMG/M |
| 3300020582|Ga0210395_10222836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300021168|Ga0210406_11262294 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021406|Ga0210386_10542791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1005 | Open in IMG/M |
| 3300021441|Ga0213871_10183219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300021475|Ga0210392_11081917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300021560|Ga0126371_11097453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300021560|Ga0126371_11188070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300021560|Ga0126371_11438758 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300021560|Ga0126371_13745024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300021560|Ga0126371_13940322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300022724|Ga0242665_10094486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 877 | Open in IMG/M |
| 3300025910|Ga0207684_11534746 | Not Available | 541 | Open in IMG/M |
| 3300027783|Ga0209448_10068472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 1194 | Open in IMG/M |
| 3300031040|Ga0265754_1013881 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 678 | Open in IMG/M |
| 3300031231|Ga0170824_103779464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300031231|Ga0170824_103782841 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031474|Ga0170818_111178892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1023 | Open in IMG/M |
| 3300031561|Ga0318528_10294162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
| 3300031572|Ga0318515_10719610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 528 | Open in IMG/M |
| 3300031668|Ga0318542_10336260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300031681|Ga0318572_10289983 | Not Available | 966 | Open in IMG/M |
| 3300031708|Ga0310686_111440181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300031708|Ga0310686_117423899 | Not Available | 625 | Open in IMG/M |
| 3300031719|Ga0306917_10525936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
| 3300031724|Ga0318500_10366819 | Not Available | 713 | Open in IMG/M |
| 3300031744|Ga0306918_10195407 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300031744|Ga0306918_10559275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 896 | Open in IMG/M |
| 3300031751|Ga0318494_10422731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300031754|Ga0307475_10762944 | Not Available | 769 | Open in IMG/M |
| 3300031771|Ga0318546_11248485 | Not Available | 522 | Open in IMG/M |
| 3300031781|Ga0318547_10641493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 659 | Open in IMG/M |
| 3300031792|Ga0318529_10004100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4920 | Open in IMG/M |
| 3300031795|Ga0318557_10135102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1110 | Open in IMG/M |
| 3300031805|Ga0318497_10328660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300031805|Ga0318497_10643441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300031824|Ga0307413_11825476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300031833|Ga0310917_10396166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 938 | Open in IMG/M |
| 3300031879|Ga0306919_10345181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1136 | Open in IMG/M |
| 3300031879|Ga0306919_10396494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300031879|Ga0306919_10626766 | Not Available | 829 | Open in IMG/M |
| 3300031890|Ga0306925_11200703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300031890|Ga0306925_11766274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300031910|Ga0306923_11362115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300031912|Ga0306921_10252567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2066 | Open in IMG/M |
| 3300031912|Ga0306921_11041015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300031941|Ga0310912_10081086 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
| 3300031941|Ga0310912_10509268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300031954|Ga0306926_11528897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 769 | Open in IMG/M |
| 3300031954|Ga0306926_12162997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300031959|Ga0318530_10093318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1190 | Open in IMG/M |
| 3300031959|Ga0318530_10489999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300031962|Ga0307479_12105956 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300032001|Ga0306922_10650486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1113 | Open in IMG/M |
| 3300032001|Ga0306922_12050479 | Not Available | 556 | Open in IMG/M |
| 3300032025|Ga0318507_10475764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300032035|Ga0310911_10128218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1414 | Open in IMG/M |
| 3300032035|Ga0310911_10811800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300032043|Ga0318556_10651141 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032051|Ga0318532_10288866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300032060|Ga0318505_10458429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300032063|Ga0318504_10199852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 933 | Open in IMG/M |
| 3300032068|Ga0318553_10072465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1727 | Open in IMG/M |
| 3300032068|Ga0318553_10499767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300032076|Ga0306924_10809838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300032094|Ga0318540_10355702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300032180|Ga0307471_101029132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 990 | Open in IMG/M |
| 3300032261|Ga0306920_101496850 | Not Available | 964 | Open in IMG/M |
| 3300033289|Ga0310914_10336283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1364 | Open in IMG/M |
| 3300033417|Ga0214471_10284943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1346 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_05337930 | 2189573000 | Grass Soil | IKFAFPTVSVTGDGEASAATAAVAQRGLELTHPAAAAAE |
| Ga0062385_109902162 | 3300004080 | Bog Forest Soil | ANGVKFAFPTVQIASDGEPSPAATAGAAKRALELTKPAAAAAE* |
| Ga0062388_1011749302 | 3300004635 | Bog Forest Soil | FDENGIKFAVPTVQVAGEGDTATAAAAQRALKLTQTAAV* |
| Ga0070667_1001594062 | 3300005367 | Switchgrass Rhizosphere | ANGIKFAIPTVQLSGDGDPSKPATAAAVAHQTLQLTQPAAAE* |
| Ga0070714_1004496681 | 3300005435 | Agricultural Soil | ANGIKFAFPTVQVAGEGEASTAAVAQRALELTRPAAAAAE* |
| Ga0066903_1039957491 | 3300005764 | Tropical Forest Soil | ENGIKFAFPTVQVAGEAEAANAAVAQHALELTRPAAA* |
| Ga0070766_110707791 | 3300005921 | Soil | ANGIKFAFPTVQIAGDGEPSAAAVAHRALELTQPAAA* |
| Ga0070717_114933942 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DANGIKFAYPTVQIAGDGEPSSAAVAHRALELTQPAAA* |
| Ga0099791_103637161 | 3300007255 | Vadose Zone Soil | NGIKFAFPTVSVTGEGEASAATGAVAQRALELTHPAAAAAD* |
| Ga0066710_1016592973 | 3300009012 | Grasslands Soil | GIKFAFPTVSVAGEGEPATAALAQRGLELTRPSAAAAE |
| Ga0066709_1037249542 | 3300009137 | Grasslands Soil | KFAFPTVSVTGEGEPATAAVAQRALELTHPAAAAE* |
| Ga0126376_106155191 | 3300010359 | Tropical Forest Soil | KFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA* |
| Ga0126372_127542482 | 3300010360 | Tropical Forest Soil | EFAFPTVQVAGGGEPTVAAARQGLEMMKPPAAEA* |
| Ga0126378_113120812 | 3300010361 | Tropical Forest Soil | DENDIKFAFPTVQVAGEGAPATTAVAQRALELTRPAAAE* |
| Ga0126378_116639801 | 3300010361 | Tropical Forest Soil | GIKFAFPTVQVAGEGETPTAAVAQRALELTQPAAAAE* |
| Ga0126378_119740411 | 3300010361 | Tropical Forest Soil | FAFPTVQVAGDGEPSTAAVAQRGLELTRPQPEAAE* |
| Ga0126378_132301332 | 3300010361 | Tropical Forest Soil | NGIKFAFPTVQVAGDAEPATAAAARQALALAQPQPQAAE* |
| Ga0126381_1012663731 | 3300010376 | Tropical Forest Soil | GIKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA* |
| Ga0126381_1014648851 | 3300010376 | Tropical Forest Soil | NGIKFAFPTVQVAGEGEPATSAAAQHALELTRPVAAA* |
| Ga0126381_1038859991 | 3300010376 | Tropical Forest Soil | FDENAIKFAFPTVQVAGDREPVEVAAAQKALTLTQPTAA* |
| Ga0126383_135594381 | 3300010398 | Tropical Forest Soil | SGIKFAFPTVQVAGEGEAATAAVAQRGLDLTRPQPAAAE* |
| Ga0150983_129680211 | 3300011120 | Forest Soil | GIKFAFPTVQIAGEGDAATAAIAERALELTRPQAAE* |
| Ga0137376_107714681 | 3300012208 | Vadose Zone Soil | IKFAFPTVSVTGEGEPATAAVAQRGLELTHPAAAAAE* |
| Ga0137376_110792943 | 3300012208 | Vadose Zone Soil | FAFPTVSVAGEGEPATAALAQRGLELTRPSAAAAE* |
| Ga0164303_107940342 | 3300012957 | Soil | ENGIKFAFPTVSVTGEGEPATAAVAQRALELTHPAAAAAE* |
| Ga0182036_105048511 | 3300016270 | Soil | NGIKFAFPTVQVAGEGEAATAAVAQRGLELTQPAAA |
| Ga0182032_102571091 | 3300016357 | Soil | GIKFAFPTVQVAGESEVATAAVAQRGLELIRPQAATGE |
| Ga0182034_100604283 | 3300016371 | Soil | IKFAFPTVQVAGEGEASTAAVAQRALELTQPQAAA |
| Ga0182037_120583322 | 3300016404 | Soil | KFAFPTVQVAGEGEPTTAAVAQRGLELTHPAAAAAQ |
| Ga0187819_101913462 | 3300017943 | Freshwater Sediment | ANGIKFAFPTVQLAGEGEPSAHATAAVAQQALALTRPHAAE |
| Ga0066655_113577831 | 3300018431 | Grasslands Soil | FAFPTVSVAGDGEPSTAAVAQRGLELTHPAAAAAE |
| Ga0066662_115020862 | 3300018468 | Grasslands Soil | ENGIKFAFPTVQVAGESEAAGTTAAVAQRGLELTHPAAVAAE |
| Ga0210407_109785602 | 3300020579 | Soil | FAYPTVQIAGDGEPSTDATAAVAQRALELTKPAAA |
| Ga0210395_102228363 | 3300020582 | Soil | NGIKFAFPTVQVAGEGETSAATAAVAQRTLELAKPAAA |
| Ga0210406_112622941 | 3300021168 | Soil | GIKFAFPTVQIAGDGEPSTDATAAVAHRALELTKPTAA |
| Ga0210386_105427911 | 3300021406 | Soil | FAYPTVQIAGDGEPSRAAVAQRALELTRPAAAAAE |
| Ga0213871_101832192 | 3300021441 | Rhizosphere | ENGIKFAFPTVQIAGEGEAAAAAAARHALELTQPTAAE |
| Ga0210392_110819172 | 3300021475 | Soil | WIKFAFPTVQIAGEGEPATAAVAQRGLELTHPAAAAAE |
| Ga0126371_110974532 | 3300021560 | Tropical Forest Soil | ENGIKFAFPTVQVAGEGEPATVAVAQRAPELTQPAAA |
| Ga0126371_111880701 | 3300021560 | Tropical Forest Soil | GIKFAFPTVQVAGEGEAATTAVAQRGLELTRPQPAAAAE |
| Ga0126371_114387581 | 3300021560 | Tropical Forest Soil | IKFAFPTVQVAGEGESATAAVAQRGPELTRSQPAAAE |
| Ga0126371_137450241 | 3300021560 | Tropical Forest Soil | ENGIKFAFPTVQVAGGGEGATATAVARQALELSRQQAAE |
| Ga0126371_139403221 | 3300021560 | Tropical Forest Soil | ENGIKFAFPTVQVAGEGAPATTAVAQRALELTRPAAAE |
| Ga0242665_100944861 | 3300022724 | Soil | RHQIRLPTVQVAGEGDTSAATAAVAQRTLELVKPAVV |
| Ga0207684_115347462 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | NGIKFAFPTVSVTGEGEPVTAATAAVAQRALELTHPAAAAADS |
| Ga0209448_100684722 | 3300027783 | Bog Forest Soil | ENGIKFAFPTVSVTGEGETSAATAAIAQRTLELAKPAAAAA |
| Ga0265754_10138811 | 3300031040 | Soil | GIKFAYPTVQLAGDGEPATAAIAQQALQLTHPTAAAAE |
| Ga0170824_1037794641 | 3300031231 | Forest Soil | NGIKFAFPTVQVAGEGEPSRGAIAQEGLALTRPQAAE |
| Ga0170824_1037828411 | 3300031231 | Forest Soil | NGIKFAFPTVQVAGEGEPSRGAIAQEGLALTRPQEAE |
| Ga0170818_1111788921 | 3300031474 | Forest Soil | KFAFPTVQIAGDGEPSTAATAAVAQRALELTKPAAA |
| Ga0318528_102941622 | 3300031561 | Soil | KFAFPTVQVAGEGEPSTAAVAQRGLELTHPAAAAAAQ |
| Ga0318515_107196101 | 3300031572 | Soil | CNGIKFAFPTVQIAGDGEPSTAATAGAAQRALEMTQPAAA |
| Ga0318542_103362601 | 3300031668 | Soil | IKVAVPTVQVAGEGEASTAAVAQRALELTQPQAAA |
| Ga0318572_102899831 | 3300031681 | Soil | IKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA |
| Ga0310686_1114401811 | 3300031708 | Soil | GIKFAFPTVQVAGEGDTPAATAAVAQRALELTRPAAAAAR |
| Ga0310686_1174238991 | 3300031708 | Soil | FDENGIKFAFPTVQLAGDGDPSTAAIAQRTLELLHPATV |
| Ga0306917_105259361 | 3300031719 | Soil | KFAFPTVQVAGEGEPSTAAVAQRGLELTRPAAAAAE |
| Ga0318500_103668192 | 3300031724 | Soil | IKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA |
| Ga0306918_101954071 | 3300031744 | Soil | NGIKFAFPTVQVAGEGEPATAAAAQHALELSRPVAAA |
| Ga0306918_105592752 | 3300031744 | Soil | EHGIKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA |
| Ga0318494_104227311 | 3300031751 | Soil | GIKFAFPTVQVAGETEAATAAVAQHALGLTRPVAAG |
| Ga0307475_107629441 | 3300031754 | Hardwood Forest Soil | ENGIKFAFPTVSVTGEGEPSNAAVAQRTLELVHPAPV |
| Ga0318546_112484851 | 3300031771 | Soil | HGIKFAFPTVQVAGQGEAATAAVAHRTLELTQPPAAA |
| Ga0318547_106414932 | 3300031781 | Soil | GIKVAFTTVQVAGESEPSTAAVAQRALELTQPAAA |
| Ga0318529_100041005 | 3300031792 | Soil | FAFPTVQVAGEGEPSTAAVAQRGLELTHPAAAAAAQ |
| Ga0318557_101351023 | 3300031795 | Soil | IKFAFPTVQLAGEGEPSPAATAAVAQQALQLTRPAAAAAE |
| Ga0318497_103286601 | 3300031805 | Soil | GIKFAFPTVQVAGEAEAATAAVAQHGLELTRPAAA |
| Ga0318497_106434411 | 3300031805 | Soil | GIKFAFPTVQVAGEGDTSAATAAVAQRALELTHPAAAAAE |
| Ga0307413_118254762 | 3300031824 | Rhizosphere | NGIKFAFPTVQVAGGAEGPVAPAVAQQAIDMLEKPAAE |
| Ga0310917_103961661 | 3300031833 | Soil | IKFAFPTVQVAGEGEPSRAAIAREALELTRPAAAAAE |
| Ga0306919_103451811 | 3300031879 | Soil | IKFAFPTVQVAGEAEPATTTAAVPQRGLELTQPAAA |
| Ga0306919_103964943 | 3300031879 | Soil | GIKFAFPTVQVAGEGEAATAAVAHRTLELTQPPAAA |
| Ga0306919_106267661 | 3300031879 | Soil | KAFDENDIKFAFPTVQVAGETEAATAAVAQHALGLTRPVAAG |
| Ga0306925_112007032 | 3300031890 | Soil | EHGIKFAFPTVQVAGDGEAATAAVAQRGLELTRPQPEAAE |
| Ga0306925_117662742 | 3300031890 | Soil | NGIKFAFPTVQIAGEGEAANAAAARRVLELTQPAAAE |
| Ga0306923_113621151 | 3300031910 | Soil | FAFPTVQVAGGEGEPSTAAVAQRGLELTHPQAAAAAE |
| Ga0306921_102525674 | 3300031912 | Soil | GIKFAFPTVQVAGEGEPATAAVAQRGLELTHPAAAAE |
| Ga0306921_110410151 | 3300031912 | Soil | FAYPTVQVAGAGEGESTTAAVSQQALELTRPQAAE |
| Ga0310912_100810863 | 3300031941 | Soil | DENGIKFAFPTVQVAGEGEPSRAAIAREALELTRPAAAAAE |
| Ga0310912_105092683 | 3300031941 | Soil | DANGIKFAFPTVQLAGEGEPSPAATAAVAQQALQLTRPAAAAAE |
| Ga0306926_115288971 | 3300031954 | Soil | IKFAFPTVQVAGEGEAATAAVAQRGLELTRPQPAAAE |
| Ga0306926_121629971 | 3300031954 | Soil | MSDLLVIAFPTVQVAGEGKAAVADLARRALELTQPAAAE |
| Ga0318530_100933181 | 3300031959 | Soil | PTVQLAGEGEPSPAATAAVAQQALQLTRPAAAAAE |
| Ga0318530_104899991 | 3300031959 | Soil | DENGIKFAFPTVQVAGEAEATTAAVAQRGLELTQPAAA |
| Ga0307479_121059562 | 3300031962 | Hardwood Forest Soil | IKFAFPTVQIAGEGDAATAAIAERALELTRPQAHAAE |
| Ga0306922_106504862 | 3300032001 | Soil | GIKFAFPTVQVAGDGEPSTAAVAQRGLELTHPAAAAAE |
| Ga0306922_120504791 | 3300032001 | Soil | GIKFAFPTVQVAGETEAATAAVAQRALELAHPAAAE |
| Ga0318507_104757641 | 3300032025 | Soil | GIKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA |
| Ga0310911_101282183 | 3300032035 | Soil | ENSIKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA |
| Ga0310911_108118002 | 3300032035 | Soil | NGIKFAFPTVQVAGETEGAAAAAVAQRGLELTQPAAA |
| Ga0318556_106511413 | 3300032043 | Soil | IKFAFPTVQVAGEGDASAATAAVAQRTLELTHPAAA |
| Ga0318532_102888662 | 3300032051 | Soil | FSFPTVQVAGEGEPSTAAVAQRGLELTRPQPAAAE |
| Ga0318505_104584291 | 3300032060 | Soil | NGIKFAFPTVQVAGETEAATAAVAQHALGLTQPVAAE |
| Ga0318504_101998522 | 3300032063 | Soil | KFAFPTVQVAGGEGEPSTAAVAQRGLELTHPQAAAAAE |
| Ga0318553_100724654 | 3300032068 | Soil | FAFPTVQVAGEGEPSTAAVAQRGLELTRPAAAAAE |
| Ga0318553_104997672 | 3300032068 | Soil | IKFAFPTVQVAGEGEPSTAAVAQRGLELTHPAAAAAAQ |
| Ga0306924_108098382 | 3300032076 | Soil | IKFAFPTVQVAGEGEPATAAAAQHALELTRPVEAA |
| Ga0318540_103557021 | 3300032094 | Soil | FAFPTVQVAGEGEPSRAAIAREALELTRPAAAAAE |
| Ga0307471_1010291322 | 3300032180 | Hardwood Forest Soil | GIKFAFPTVSVTGEGEPATAATAAVAQRGLELTHPVVAAAE |
| Ga0306920_1014968501 | 3300032261 | Soil | ENAIKFAFPTVQVAGEGEPATAAAAQHALELTRPVAAA |
| Ga0310914_103362831 | 3300033289 | Soil | NGIKFAFPTVQVAGEGEAATAAVAQRALELTQPAAA |
| Ga0214471_102849434 | 3300033417 | Soil | FDQNGIKFAFPTVQGAGSGDAAAVAAARQGLGLTLPPPAA |
| ⦗Top⦘ |