


| Basic Information | |
|---|---|
| Family ID | F100058 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLLSFAYLAFSAVLRLLVRRRRSEFAKDVELLVLRHQLM |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.23 % |
| % of genes near scaffold ends (potentially truncated) | 85.44 % |
| % of genes from short scaffolds (< 2000 bps) | 95.15 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.010 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.748 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.311 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF03551 | PadR | 1.94 |
| PF00583 | Acetyltransf_1 | 1.94 |
| PF00665 | rve | 1.94 |
| PF13683 | rve_3 | 1.94 |
| PF13649 | Methyltransf_25 | 1.94 |
| PF00072 | Response_reg | 0.97 |
| PF13088 | BNR_2 | 0.97 |
| PF13458 | Peripla_BP_6 | 0.97 |
| PF02567 | PhzC-PhzF | 0.97 |
| PF00534 | Glycos_transf_1 | 0.97 |
| PF00078 | RVT_1 | 0.97 |
| PF13276 | HTH_21 | 0.97 |
| PF13462 | Thioredoxin_4 | 0.97 |
| PF04024 | PspC | 0.97 |
| PF01223 | Endonuclease_NS | 0.97 |
| PF04134 | DCC1-like | 0.97 |
| PF05671 | GETHR | 0.97 |
| PF02371 | Transposase_20 | 0.97 |
| PF05147 | LANC_like | 0.97 |
| PF03176 | MMPL | 0.97 |
| PF02142 | MGS | 0.97 |
| PF09922 | DUF2154 | 0.97 |
| PF08125 | Mannitol_dh_C | 0.97 |
| PF00532 | Peripla_BP_1 | 0.97 |
| PF13508 | Acetyltransf_7 | 0.97 |
| PF10282 | Lactonase | 0.97 |
| PF00484 | Pro_CA | 0.97 |
| PF12850 | Metallophos_2 | 0.97 |
| PF08241 | Methyltransf_11 | 0.97 |
| PF07730 | HisKA_3 | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF01544 | CorA | 0.97 |
| PF06778 | Chlor_dismutase | 0.97 |
| PF01810 | LysE | 0.97 |
| PF07920 | DUF1684 | 0.97 |
| PF13490 | zf-HC2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.94 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.94 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.94 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.94 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.94 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.94 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.94 |
| COG0246 | Mannitol-1-phosphate/altronate dehydrogenases | Carbohydrate transport and metabolism [G] | 0.97 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.97 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.97 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.97 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.97 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.97 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.97 |
| COG3253 | Coproheme decarboxylase/chlorite dismutase | Coenzyme transport and metabolism [H] | 0.97 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.97 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.97 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.97 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.97 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.11 % |
| Unclassified | root | N/A | 36.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig920111 | Not Available | 514 | Open in IMG/M |
| 2170459012|GOYVCMS01B6753 | Not Available | 502 | Open in IMG/M |
| 2170459018|G1P06HT01CAUM3 | Not Available | 585 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101604591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8 | 1054 | Open in IMG/M |
| 3300000955|JGI1027J12803_109184662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1550 | Open in IMG/M |
| 3300000956|JGI10216J12902_101763577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
| 3300000956|JGI10216J12902_102618111 | Not Available | 664 | Open in IMG/M |
| 3300000956|JGI10216J12902_102788004 | Not Available | 945 | Open in IMG/M |
| 3300000956|JGI10216J12902_102908042 | Not Available | 772 | Open in IMG/M |
| 3300000956|JGI10216J12902_117508310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300004463|Ga0063356_102135052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300005177|Ga0066690_10586103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 745 | Open in IMG/M |
| 3300005179|Ga0066684_10173154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1383 | Open in IMG/M |
| 3300005187|Ga0066675_11089831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300005468|Ga0070707_100501454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1175 | Open in IMG/M |
| 3300005552|Ga0066701_10977470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300005553|Ga0066695_10765744 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005598|Ga0066706_10173684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1639 | Open in IMG/M |
| 3300006046|Ga0066652_101869571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 540 | Open in IMG/M |
| 3300009012|Ga0066710_101222333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1164 | Open in IMG/M |
| 3300009012|Ga0066710_103598706 | Not Available | 584 | Open in IMG/M |
| 3300009137|Ga0066709_100186202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2709 | Open in IMG/M |
| 3300009137|Ga0066709_101059769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1190 | Open in IMG/M |
| 3300009137|Ga0066709_102596086 | Not Available | 679 | Open in IMG/M |
| 3300009137|Ga0066709_103729787 | Not Available | 553 | Open in IMG/M |
| 3300010036|Ga0126305_10211834 | Not Available | 1232 | Open in IMG/M |
| 3300010038|Ga0126315_10799623 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300010041|Ga0126312_11382990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300010042|Ga0126314_11273449 | Not Available | 550 | Open in IMG/M |
| 3300010045|Ga0126311_11908776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300010047|Ga0126382_12126617 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010166|Ga0126306_11561397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora tropica | 549 | Open in IMG/M |
| 3300010323|Ga0134086_10310349 | Not Available | 614 | Open in IMG/M |
| 3300010323|Ga0134086_10353334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300011269|Ga0137392_10456709 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300011992|Ga0120146_1081030 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012022|Ga0120191_10028007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
| 3300012092|Ga0136621_1230671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300012096|Ga0137389_10514919 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300012189|Ga0137388_10535740 | Not Available | 1088 | Open in IMG/M |
| 3300012189|Ga0137388_11696494 | Not Available | 566 | Open in IMG/M |
| 3300012198|Ga0137364_10651685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300012201|Ga0137365_10070029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2646 | Open in IMG/M |
| 3300012201|Ga0137365_10395089 | Not Available | 1020 | Open in IMG/M |
| 3300012204|Ga0137374_10205664 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300012204|Ga0137374_10883125 | Not Available | 658 | Open in IMG/M |
| 3300012206|Ga0137380_10203616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1794 | Open in IMG/M |
| 3300012206|Ga0137380_11019823 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012207|Ga0137381_10446959 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300012208|Ga0137376_11506441 | Not Available | 564 | Open in IMG/M |
| 3300012209|Ga0137379_11267039 | Not Available | 644 | Open in IMG/M |
| 3300012209|Ga0137379_11573713 | Not Available | 557 | Open in IMG/M |
| 3300012209|Ga0137379_11604236 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012210|Ga0137378_11661405 | Not Available | 546 | Open in IMG/M |
| 3300012353|Ga0137367_10453389 | Not Available | 906 | Open in IMG/M |
| 3300012353|Ga0137367_10701699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
| 3300012354|Ga0137366_10224869 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300012354|Ga0137366_11105633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300012355|Ga0137369_10231413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1409 | Open in IMG/M |
| 3300012355|Ga0137369_10448652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 921 | Open in IMG/M |
| 3300012356|Ga0137371_11364007 | Not Available | 522 | Open in IMG/M |
| 3300012358|Ga0137368_10332556 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300012360|Ga0137375_10007171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13246 | Open in IMG/M |
| 3300012360|Ga0137375_10409381 | Not Available | 1182 | Open in IMG/M |
| 3300012360|Ga0137375_10776231 | Not Available | 774 | Open in IMG/M |
| 3300012360|Ga0137375_10889858 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012360|Ga0137375_11473342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300012532|Ga0137373_11084163 | Not Available | 574 | Open in IMG/M |
| 3300012532|Ga0137373_11099796 | Not Available | 568 | Open in IMG/M |
| 3300012930|Ga0137407_12042926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora purpureochromogenes | 547 | Open in IMG/M |
| 3300012948|Ga0126375_12038880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora purpureochromogenes | 508 | Open in IMG/M |
| 3300012957|Ga0164303_11105211 | Not Available | 573 | Open in IMG/M |
| 3300012960|Ga0164301_11106282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300012971|Ga0126369_11928713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
| 3300013764|Ga0120111_1102312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300013770|Ga0120123_1014932 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300013772|Ga0120158_10312185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300013772|Ga0120158_10343333 | Not Available | 705 | Open in IMG/M |
| 3300014823|Ga0120170_1071713 | Not Available | 732 | Open in IMG/M |
| 3300014827|Ga0120171_1057714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1138 | Open in IMG/M |
| 3300015371|Ga0132258_13900424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1014 | Open in IMG/M |
| 3300015373|Ga0132257_103248317 | Not Available | 592 | Open in IMG/M |
| 3300017657|Ga0134074_1276852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300018071|Ga0184618_10367190 | Not Available | 612 | Open in IMG/M |
| 3300018482|Ga0066669_10243106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1416 | Open in IMG/M |
| 3300018482|Ga0066669_10429852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1128 | Open in IMG/M |
| 3300018482|Ga0066669_12395684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia → Georgenia satyanarayanai | 506 | Open in IMG/M |
| 3300019255|Ga0184643_1340189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
| 3300019887|Ga0193729_1000018 | All Organisms → cellular organisms → Bacteria | 79607 | Open in IMG/M |
| 3300021073|Ga0210378_10307158 | Not Available | 595 | Open in IMG/M |
| 3300022756|Ga0222622_10228271 | Not Available | 1250 | Open in IMG/M |
| 3300026309|Ga0209055_1139123 | Not Available | 870 | Open in IMG/M |
| 3300026326|Ga0209801_1106799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1208 | Open in IMG/M |
| 3300026523|Ga0209808_1195956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 680 | Open in IMG/M |
| 3300027882|Ga0209590_10837323 | Not Available | 583 | Open in IMG/M |
| 3300028778|Ga0307288_10073658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1211 | Open in IMG/M |
| 3300028878|Ga0307278_10006371 | All Organisms → cellular organisms → Bacteria | 5623 | Open in IMG/M |
| 3300028878|Ga0307278_10062748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1678 | Open in IMG/M |
| 3300028878|Ga0307278_10125025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1155 | Open in IMG/M |
| 3300028878|Ga0307278_10501848 | Not Available | 530 | Open in IMG/M |
| 3300028884|Ga0307308_10180732 | Not Available | 1010 | Open in IMG/M |
| 3300031681|Ga0318572_10435930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 780 | Open in IMG/M |
| 3300031740|Ga0307468_102463937 | Not Available | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.74% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.80% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_15335670 | 2124908045 | Soil | MFLSFAYLAFCAVLKLLVGRRRTEFAKDVELMVLRHQLM |
| N56_00450750 | 2170459012 | Grass Soil | MLLSFAYLGFSALLRLLVGRRRSAFVKDVELLVLRHQLAV |
| 2MG_02767660 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MLLSFAYLAFSAILRLLVGRSAKHVGEGVELLVLRHQLAVLVGN |
| INPhiseqgaiiFebDRAFT_1016045912 | 3300000364 | Soil | MLLPFAYLAFAAVLKLLVRGRRAEFAKDVELVLLRHQLSVLARQQQ |
| JGI1027J12803_1091846621 | 3300000955 | Soil | MLLSFAYLAFSAVLRMLVRDRRSEFAKGVELLVLRHQLVVLR |
| JGI10216J12902_1017635771 | 3300000956 | Soil | MLISFAYLAFSAVLRLVVSGRSSEFAKDVELLVLRHQLVVLGRRQRHP |
| JGI10216J12902_1026181112 | 3300000956 | Soil | MLSFAYLAFAAVLKLLARSRRAEFTKDVELVLLRHQLSVLARQHQS |
| JGI10216J12902_1027880042 | 3300000956 | Soil | MLLPFAYLAFAAVLRLLVRGRRAEFAKDVELVLLRHQL |
| JGI10216J12902_1029080423 | 3300000956 | Soil | MILSFGYLAFSALLRLVTRRPRTERAKDVELGGLIHQYHRAAA* |
| JGI10216J12902_1175083102 | 3300000956 | Soil | MLLSFAYLAFSAVLRLLIRHRSSEFAKDVELLVWRHQ |
| Ga0063356_1021350521 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLPSFAYLAFSAVLQLLLGRRRSEFAKDVELLVLRHQLAVLGRQEMRAPL |
| Ga0066690_105861031 | 3300005177 | Soil | MLLSFVYLAFSALLQLLMGSRRSEFAKDVELLVLRHQLLVLRRQ |
| Ga0066684_101731541 | 3300005179 | Soil | MLLSFAYLAFAAVLRLLVRGRRAEFAKDVELVLLRHQLSVLARQH* |
| Ga0066675_110898311 | 3300005187 | Soil | MLLSFAYLTFAAFLRLLVRGRRAEFAKDVELVLLRHQLSVLTRQHRPHRLRPADRAFFAA |
| Ga0070707_1005014541 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLSFAYFAFGAILRLLVGGRRGEFDKDIELIVLRHQLTVLRRRGERSK |
| Ga0066701_109774701 | 3300005552 | Soil | MLLSFAYLAFVAVLRLLVRGRRAEFSKDVELVLLRHQLARQ |
| Ga0066695_107657441 | 3300005553 | Soil | MLVSFAHLAFSAMLRLLVGRRRSSFANEIELLVLR |
| Ga0066706_101736841 | 3300005598 | Soil | MLLSFAYLAFSAVLRLLVGRRGSEFAKDVELLVLR |
| Ga0066652_1018695712 | 3300006046 | Soil | MLLSFAYLAFAAILRPLVRGRRAEFAKDVELVLLRHQLSVLARQQ |
| Ga0066710_1012223331 | 3300009012 | Grasslands Soil | MLLSFAYLAFSALLKLLVGRRRNEFANDVELMVLRHQLDVLGRQAARPSLRPA |
| Ga0066710_1035987062 | 3300009012 | Grasslands Soil | MLLSFAYLAFSAVLRLLVRDRRSEFAKDLELLVLRHQLAVLG |
| Ga0066709_1001862023 | 3300009137 | Grasslands Soil | MLLSFAYLAFSAVLRLLVGRRGSEFAKDVELLVLRH |
| Ga0066709_1010597691 | 3300009137 | Grasslands Soil | MLLSFAYLAFSALLKLLVRSRRTEFAKDVELVLLRHQLS |
| Ga0066709_1025960861 | 3300009137 | Grasslands Soil | MLLSFAYLAFASLLRLLAARRRDEFAKDGHVSSV* |
| Ga0066709_1037297871 | 3300009137 | Grasslands Soil | MLLSFAYFAFSAVLRLVVGRRRSEFAKDLELLVLRHQLIVLGR |
| Ga0126305_102118341 | 3300010036 | Serpentine Soil | MLLSFAYLAFSAVLRLLVRNRQTELAKDVELLVLRHQLAVLTR |
| Ga0126315_107996232 | 3300010038 | Serpentine Soil | MFLSFAYLAFSPVLRLLVGGRSSEFAKDVELLVLRHQLAVL |
| Ga0126312_113829901 | 3300010041 | Serpentine Soil | MLLSFAYLAFSAVLRLLVRGRRSEFAKDLELLVLRHQLAVL |
| Ga0126314_112734491 | 3300010042 | Serpentine Soil | MLLSFAYLMFSAVLSLLVRRRQPEFATDLELIVLRHQLSVLSRRHQRR |
| Ga0126311_119087762 | 3300010045 | Serpentine Soil | DEHRPMFLSFAYLAFLAVLRLLVRGRRREFAKDLELLV* |
| Ga0126382_121266172 | 3300010047 | Tropical Forest Soil | MLLSFAYLAFSTLLRLLVQGRRSEFAKDVELLVLRH* |
| Ga0126306_115613971 | 3300010166 | Serpentine Soil | MLLSFAYLAFAAFLRLLFRGRRAEFANDVELVLLRHQLSVLTRQHRPHRLRPADRAFI |
| Ga0134086_103103491 | 3300010323 | Grasslands Soil | MLLSFAYLAFSALLRLLVGGRRSELAKEIELLVLRHQLV |
| Ga0134086_103533341 | 3300010323 | Grasslands Soil | MLLSFAYFAFGAILRLLVGGRRGEFDKDIELIVLRHQLTVLRRRGERPKLK |
| Ga0137392_104567091 | 3300011269 | Vadose Zone Soil | MLLSFAYFAFGAILRLLVGGRRGEFDKDIELIVLRHQL |
| Ga0120146_10810301 | 3300011992 | Permafrost | MLLSFAYLAFSAVLRLLVRPRSSELAKDVELLVLLDRQQ* |
| Ga0120191_100280071 | 3300012022 | Terrestrial | MLLSFAYLAFAAVLRLLVRGRRAEFAKDVALVLLPHHLSVLAPP |
| Ga0136621_12306712 | 3300012092 | Polar Desert Sand | MLLSFAYLAFSTLLRLLVRGRRSEFTKDVELLVCARGVH* |
| Ga0137389_105149192 | 3300012096 | Vadose Zone Soil | MLLSFAYLAFAAVLRLLVRGRRPEFAKDVELVLLRHQLSILTRQQQ |
| Ga0137388_105357403 | 3300012189 | Vadose Zone Soil | MLLSFVYRAFSAVLRLLVRGRRDEFARDGELLGLRHQLVVLG* |
| Ga0137388_116964942 | 3300012189 | Vadose Zone Soil | MLLSFAYFAFGAILRLLVGGRRGEFDKDIELIVLRHQLTVLR |
| Ga0137364_106516853 | 3300012198 | Vadose Zone Soil | FAYLAFSALLRLLLSGPRSGLAKDLELLVLRHQLAVLGRQERTSS* |
| Ga0137365_100700291 | 3300012201 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVRRRSSEFAKDVELLVLRHQLVVLSRQQPR |
| Ga0137365_103950891 | 3300012201 | Vadose Zone Soil | VFFSFAYLAFSAVLRLLIGGRRSEFAKDVELLLLRHQ |
| Ga0137374_102056641 | 3300012204 | Vadose Zone Soil | MLISFAYLAFSALLRLLVRSRQSEFAKDVELVLLRHQLSVLARD* |
| Ga0137374_108831251 | 3300012204 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVRRRRSEFAKDVELLVLRHQLM |
| Ga0137380_102036161 | 3300012206 | Vadose Zone Soil | MLLSFAYLAFSALLRLLVGGRRSEFAKDIELVVL* |
| Ga0137380_110198232 | 3300012206 | Vadose Zone Soil | MLLSSVYLAFSVVLRLLVGNRRGELAKDVERLVLRHQQ |
| Ga0137381_104469591 | 3300012207 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVRGRRSEFAKDVELLVLRH |
| Ga0137376_115064412 | 3300012208 | Vadose Zone Soil | MLLSFVYLAFSALLQLLMGGRRSEFTKDVELLVLRHQLLLLRRQQ |
| Ga0137379_112670392 | 3300012209 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVSGRSSEVAKDVELLVLRHQLVVLG |
| Ga0137379_115737131 | 3300012209 | Vadose Zone Soil | MFLSFVYLAFSVVLRLLVTDRRSEFDKVVELLVLRHQLAVL |
| Ga0137379_116042362 | 3300012209 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVRTRSSELVKDVELLVLRHQLVVLNRHERR |
| Ga0137378_116614052 | 3300012210 | Vadose Zone Soil | MLLSFAYLAFSALLRLLVSGRGSEFAKDVELLVLRHQLLVLSRQDGLR* |
| Ga0137367_104533891 | 3300012353 | Vadose Zone Soil | MLLTFAYLAFAAVLRLLVRGRRAEFAKDVELVLLRH |
| Ga0137367_107016991 | 3300012353 | Vadose Zone Soil | MVFSFAYLAFSAVLRLLVSGRSSEFAKDVELLVLRHQ |
| Ga0137366_102248691 | 3300012354 | Vadose Zone Soil | MVLSLVYLVFVALLRLVAGGRRSELAKDVELLVLRHELAVL |
| Ga0137366_111056332 | 3300012354 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVRGRRSEFAKDLELLVLRHQLAVLG |
| Ga0137369_102314131 | 3300012355 | Vadose Zone Soil | MFLSFAYLAFSAVLKLLLGRRRGEFAKDVELKVLRHQLVVRGRQACRP |
| Ga0137369_104486521 | 3300012355 | Vadose Zone Soil | MLLSFAYLAFSALLRLLVSGRSSEFAKDVELLVLRHQLVV |
| Ga0137371_113640072 | 3300012356 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVRDRRSEFAKDLELLVLR |
| Ga0137368_103325561 | 3300012358 | Vadose Zone Soil | MLLSFAYLAFSTVLRLLVRGRRSEFTKDLELLVLRHQ |
| Ga0137375_1000717116 | 3300012360 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLVTNRRSEFAKDVELLVLRVGLQTRRGF |
| Ga0137375_104093813 | 3300012360 | Vadose Zone Soil | MCLSFAYLAFSAVLKLLVGRRRNEFAKEVELLVLRH |
| Ga0137375_107762311 | 3300012360 | Vadose Zone Soil | AYLAFSAVLRLLVGGRRSEFSKDVELLVLRHQLVVLGRQRGA* |
| Ga0137375_108898581 | 3300012360 | Vadose Zone Soil | MLLSFAYLAFSAVLRLLAGRWRSEFAKDVEPLVLRHQLVVLA* |
| Ga0137375_114733421 | 3300012360 | Vadose Zone Soil | MLLSFAYLAFSTLLRLLVRGRRSEFAKDVELLVLRH |
| Ga0137373_110841631 | 3300012532 | Vadose Zone Soil | MLLSFAYLAFSALLRLLVRRRRSEFAKDVELLVLRH |
| Ga0137373_110997961 | 3300012532 | Vadose Zone Soil | MVLSFAYRAFSAVLRLLVRRRSSEFAKDVELLVVRHQLVVLSRQQPRPS |
| Ga0137407_120429261 | 3300012930 | Vadose Zone Soil | MLLSFAYLAFAAFLRLLARDRRAEFAKDVELVLLRHQLSVLARQHQRPRLRPA |
| Ga0126375_120388801 | 3300012948 | Tropical Forest Soil | MLLSFASLAFSAVLRLLVGGRSSEFAKDVELLVLRHQLAVLGRQRRRPS |
| Ga0164303_111052112 | 3300012957 | Soil | MFLSFAYLAFCAVLKLLVGRRRNEFAKDVELMVLRHQLVVL |
| Ga0164301_111062822 | 3300012960 | Soil | MLFSFAYLALSAVLRLLVQSRGSELAKDVELLVLRHQLVVLR* |
| Ga0126369_119287132 | 3300012971 | Tropical Forest Soil | MFFSFLYLAFSGVLRLVAGGRRSEFAKDVELLVLRHQLAVLR |
| Ga0120111_11023121 | 3300013764 | Permafrost | MLLSVAYLAFSAVLRLLVGRRSSELAKDVELLVVRHQLVVLGR* |
| Ga0120123_10149324 | 3300013770 | Permafrost | MLLSFAYLAFSAVLRLLVRSRQTELAKDVELLVLRHQLSVN* |
| Ga0120158_103121853 | 3300013772 | Permafrost | MFLSFAYLAFSAVLRLLVRSWSSELAKDVELLVSRHQ |
| Ga0120158_103433332 | 3300013772 | Permafrost | MLLSFAYLAFSAVLRLLVRTRSSELAKDVELLVLRHQL |
| Ga0120170_10717133 | 3300014823 | Permafrost | MLFSFAYLAFSAVLRLLVRGRRAEFANDVEVVLLRHQLSVLA |
| Ga0120171_10577141 | 3300014827 | Permafrost | MLLSFAYLAFSAVLRLLVGRRRSEVAKDVQLLVWRHQLA |
| Ga0132258_139004242 | 3300015371 | Arabidopsis Rhizosphere | MLLSFAYLAFSAVLRLLVSGRSSEFAKDVELLVLRHQL |
| Ga0132257_1032483171 | 3300015373 | Arabidopsis Rhizosphere | VYLAFSTLLRCSCEDRRSEFAKDLELLVLRHQLHVLGRSYLWRVV* |
| Ga0134074_12768522 | 3300017657 | Grasslands Soil | VGLAFLAVLRLLVGGRSSEFAKDVELPVLRHQLVVLER |
| Ga0184618_103671902 | 3300018071 | Groundwater Sediment | MLLSFAYLAFSALLRLLLSGPRSELAKGLELLVLRHQLAVLGRQERTSS |
| Ga0066669_102431062 | 3300018482 | Grasslands Soil | MLLSLAYLAFSALLRLLIRDRRTEFAKDVELMLLRHQLSVMTRQRQR |
| Ga0066669_104298522 | 3300018482 | Grasslands Soil | MLLSFAYVAFVAVLRLLVCGRRTAFAKDVELVLLRH |
| Ga0066669_123956841 | 3300018482 | Grasslands Soil | MLLSFAYLAFSALLRLLVSRRGSELAKDVGLLVLRHQLIVLRRQQR |
| Ga0184643_13401891 | 3300019255 | Groundwater Sediment | MLLSFAYLAFSAVLRLLVGRRGSEFAKDVELLVLRHQLAVLGRQA |
| Ga0193729_100001827 | 3300019887 | Soil | MLLSFVYLAFSAVLRLLVRGRRSEFAKDVELLVRR |
| Ga0210378_103071583 | 3300021073 | Groundwater Sediment | MLLSFAYLAFAAVLRLLVRDRRTEFAKDVELMLLRHQLSVLARQHQRPRLRP |
| Ga0222622_102282712 | 3300022756 | Groundwater Sediment | MLLSFAYLGFSTVLRLLVRGRRAEFAKDVELVLLRHQL |
| Ga0209055_11391232 | 3300026309 | Soil | MLLSFAYLAFSAVLRLLVRRQRSEFAKDVELLVLRHQLVVFSRQQ |
| Ga0209801_11067992 | 3300026326 | Soil | VRGPLGLRASFAYFAFSAVLRLVVGRRRSEFAKDLELLVLRHQLI |
| Ga0209808_11959562 | 3300026523 | Soil | MLLSFAYLAFSAVLRLLVRRQRSEVAKDVELLVLRHQLVVL |
| Ga0209590_108373232 | 3300027882 | Vadose Zone Soil | MLLSFAYLAFAAVLRLLVRGRRPEFAKDVELVLLRHQLSVL |
| Ga0307288_100736582 | 3300028778 | Soil | MLLSFAYLAFSAVLRLLVGRRGSEFAKDVELLVLRHQLAVL |
| Ga0307278_100063711 | 3300028878 | Soil | MLLSFAYLAFSAVLRLLVRSRSSEFAKDVELLVLRHQ |
| Ga0307278_100627482 | 3300028878 | Soil | MLLSFAYLAFAAVLRLLVRGRRAEFAKDVELVLLRHQLSVLARQ |
| Ga0307278_101250251 | 3300028878 | Soil | LLWKHRRMLLSFAYLAFSAVLRLLAGRWRSEFAKDVELLV |
| Ga0307278_105018482 | 3300028878 | Soil | MLLSFAYLAFSAVLRLLVRGRRAEFANDVEVVLLRHQLSVLARQHQRPKLRPADS |
| Ga0307308_101807321 | 3300028884 | Soil | MSQFRWVWEDRSMLLSFAYLAFAAVLRLLVRGRRPEFAKDVE |
| Ga0318572_104359302 | 3300031681 | Soil | MFFSFLYLAFSGVLRLRAGGRRSEFAKSVELLVLRHQLT |
| Ga0307468_1024639372 | 3300031740 | Hardwood Forest Soil | MLLSFVYLAFAALLRLLVGCRRSEFAKDVELLVLRH |
| ⦗Top⦘ |