


| Basic Information | |
|---|---|
| Family ID | F100018 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITTTD |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.06 % |
| % of genes from short scaffolds (< 2000 bps) | 86.41 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.223 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.534 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.981 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.573 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 10.68 |
| PF13546 | DDE_5 | 3.88 |
| PF13565 | HTH_32 | 1.94 |
| PF02826 | 2-Hacid_dh_C | 1.94 |
| PF00239 | Resolvase | 1.94 |
| PF02796 | HTH_7 | 1.94 |
| PF13358 | DDE_3 | 1.94 |
| PF00561 | Abhydrolase_1 | 1.94 |
| PF00106 | adh_short | 0.97 |
| PF00582 | Usp | 0.97 |
| PF01555 | N6_N4_Mtase | 0.97 |
| PF01145 | Band_7 | 0.97 |
| PF00400 | WD40 | 0.97 |
| PF00440 | TetR_N | 0.97 |
| PF07681 | DoxX | 0.97 |
| PF01243 | Putative_PNPOx | 0.97 |
| PF03060 | NMO | 0.97 |
| PF01966 | HD | 0.97 |
| PF13466 | STAS_2 | 0.97 |
| PF08388 | GIIM | 0.97 |
| PF12728 | HTH_17 | 0.97 |
| PF13515 | FUSC_2 | 0.97 |
| PF01740 | STAS | 0.97 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.97 |
| PF01337 | Barstar | 0.97 |
| PF05048 | NosD | 0.97 |
| PF01526 | DDE_Tnp_Tn3 | 0.97 |
| PF13424 | TPR_12 | 0.97 |
| PF00069 | Pkinase | 0.97 |
| PF13487 | HD_5 | 0.97 |
| PF03636 | Glyco_hydro_65N | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 10.68 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.88 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.94 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.94 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.97 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.97 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.97 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.97 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.97 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.97 |
| COG2732 | Barstar, RNAse (barnase) inhibitor | Transcription [K] | 0.97 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.97 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.22 % |
| Unclassified | root | N/A | 40.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_122901329 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300001356|JGI12269J14319_10034502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 3289 | Open in IMG/M |
| 3300001431|F14TB_102635513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 602 | Open in IMG/M |
| 3300005445|Ga0070708_101324231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300005552|Ga0066701_10645746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300005554|Ga0066661_10690515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300006052|Ga0075029_100897189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 608 | Open in IMG/M |
| 3300006059|Ga0075017_100995739 | Not Available | 653 | Open in IMG/M |
| 3300006162|Ga0075030_100988754 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006577|Ga0074050_12017705 | Not Available | 553 | Open in IMG/M |
| 3300006603|Ga0074064_11527091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia → Georgenia satyanarayanai | 543 | Open in IMG/M |
| 3300009012|Ga0066710_102818397 | Not Available | 686 | Open in IMG/M |
| 3300009038|Ga0099829_10654834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300009038|Ga0099829_11060436 | Not Available | 672 | Open in IMG/M |
| 3300009089|Ga0099828_10367701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300009520|Ga0116214_1053887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1459 | Open in IMG/M |
| 3300009521|Ga0116222_1299069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300009522|Ga0116218_1417146 | Not Available | 599 | Open in IMG/M |
| 3300009523|Ga0116221_1313851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
| 3300009683|Ga0116224_10504069 | Not Available | 577 | Open in IMG/M |
| 3300009698|Ga0116216_10735828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix alba | 592 | Open in IMG/M |
| 3300010337|Ga0134062_10790201 | Not Available | 507 | Open in IMG/M |
| 3300010379|Ga0136449_100584372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1909 | Open in IMG/M |
| 3300010876|Ga0126361_11306516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 899 | Open in IMG/M |
| 3300011107|Ga0151490_1757389 | Not Available | 512 | Open in IMG/M |
| 3300012189|Ga0137388_10817736 | Not Available | 863 | Open in IMG/M |
| 3300012202|Ga0137363_10405978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1135 | Open in IMG/M |
| 3300012206|Ga0137380_10697922 | Not Available | 881 | Open in IMG/M |
| 3300012207|Ga0137381_11526276 | Not Available | 559 | Open in IMG/M |
| 3300012210|Ga0137378_10771971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300012210|Ga0137378_10911511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 792 | Open in IMG/M |
| 3300012350|Ga0137372_10272906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1321 | Open in IMG/M |
| 3300012351|Ga0137386_11146072 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012356|Ga0137371_10804014 | Not Available | 716 | Open in IMG/M |
| 3300012361|Ga0137360_11680758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300012532|Ga0137373_10627510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300016270|Ga0182036_11821897 | Not Available | 515 | Open in IMG/M |
| 3300016270|Ga0182036_11921927 | Not Available | 502 | Open in IMG/M |
| 3300016319|Ga0182033_10018108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4211 | Open in IMG/M |
| 3300016341|Ga0182035_11017362 | Not Available | 735 | Open in IMG/M |
| 3300016371|Ga0182034_11125022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300016422|Ga0182039_10876631 | Not Available | 800 | Open in IMG/M |
| 3300017928|Ga0187806_1007641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2992 | Open in IMG/M |
| 3300017928|Ga0187806_1204835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
| 3300017955|Ga0187817_10022569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3753 | Open in IMG/M |
| 3300017955|Ga0187817_10523009 | Not Available | 757 | Open in IMG/M |
| 3300017961|Ga0187778_11256172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300017974|Ga0187777_10898718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300017975|Ga0187782_11077235 | Not Available | 627 | Open in IMG/M |
| 3300018012|Ga0187810_10467543 | Not Available | 536 | Open in IMG/M |
| 3300018038|Ga0187855_10810114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori | 546 | Open in IMG/M |
| 3300018058|Ga0187766_10026581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3338 | Open in IMG/M |
| 3300018058|Ga0187766_11086130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300018060|Ga0187765_10428123 | Not Available | 823 | Open in IMG/M |
| 3300018086|Ga0187769_11066668 | Not Available | 611 | Open in IMG/M |
| 3300018482|Ga0066669_11129065 | Not Available | 707 | Open in IMG/M |
| 3300020581|Ga0210399_10360403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1214 | Open in IMG/M |
| 3300021432|Ga0210384_10043432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4116 | Open in IMG/M |
| 3300021432|Ga0210384_10650847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 945 | Open in IMG/M |
| 3300025898|Ga0207692_11191479 | Not Available | 506 | Open in IMG/M |
| 3300025910|Ga0207684_11399350 | Not Available | 573 | Open in IMG/M |
| 3300026021|Ga0208140_1021399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 901 | Open in IMG/M |
| 3300026934|Ga0207816_1045157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium gastri | 512 | Open in IMG/M |
| 3300026947|Ga0207853_1041969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium gastri | 598 | Open in IMG/M |
| 3300027882|Ga0209590_10408797 | Not Available | 877 | Open in IMG/M |
| 3300027894|Ga0209068_10834579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium gastri | 544 | Open in IMG/M |
| 3300027905|Ga0209415_11068657 | Not Available | 529 | Open in IMG/M |
| 3300030494|Ga0310037_10069818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. | 1654 | Open in IMG/M |
| 3300030617|Ga0311356_11572799 | Not Available | 592 | Open in IMG/M |
| 3300031549|Ga0318571_10418775 | Not Available | 526 | Open in IMG/M |
| 3300031564|Ga0318573_10190284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. GM8 | 1086 | Open in IMG/M |
| 3300031640|Ga0318555_10514757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium gastri | 648 | Open in IMG/M |
| 3300031671|Ga0307372_10208287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1244 | Open in IMG/M |
| 3300031708|Ga0310686_116471585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 704 | Open in IMG/M |
| 3300031713|Ga0318496_10566149 | Not Available | 628 | Open in IMG/M |
| 3300031778|Ga0318498_10530154 | Not Available | 517 | Open in IMG/M |
| 3300031792|Ga0318529_10293803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium gastri | 756 | Open in IMG/M |
| 3300031796|Ga0318576_10365090 | Not Available | 682 | Open in IMG/M |
| 3300031797|Ga0318550_10182159 | Not Available | 1014 | Open in IMG/M |
| 3300031912|Ga0306921_11892230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300031945|Ga0310913_11122630 | Not Available | 549 | Open in IMG/M |
| 3300032001|Ga0306922_10061278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3915 | Open in IMG/M |
| 3300032160|Ga0311301_10008691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 33346 | Open in IMG/M |
| 3300032160|Ga0311301_10809860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. DvalAA-43 | 1284 | Open in IMG/M |
| 3300032160|Ga0311301_11326848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 906 | Open in IMG/M |
| 3300032160|Ga0311301_11897436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 702 | Open in IMG/M |
| 3300032261|Ga0306920_100609567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1615 | Open in IMG/M |
| 3300032783|Ga0335079_10958203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
| 3300032805|Ga0335078_10773725 | Not Available | 1176 | Open in IMG/M |
| 3300032805|Ga0335078_11004813 | Not Available | 987 | Open in IMG/M |
| 3300032828|Ga0335080_10116503 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300032828|Ga0335080_10739834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1021 | Open in IMG/M |
| 3300032828|Ga0335080_11419438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300032828|Ga0335080_11912534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300032829|Ga0335070_11215167 | Not Available | 691 | Open in IMG/M |
| 3300032892|Ga0335081_10098841 | Not Available | 4347 | Open in IMG/M |
| 3300032892|Ga0335081_10163649 | All Organisms → cellular organisms → Bacteria | 3153 | Open in IMG/M |
| 3300032895|Ga0335074_11452133 | Not Available | 550 | Open in IMG/M |
| 3300032897|Ga0335071_11179503 | Not Available | 711 | Open in IMG/M |
| 3300032955|Ga0335076_10122402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2524 | Open in IMG/M |
| 3300033158|Ga0335077_11814583 | Not Available | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.53% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 13.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 13.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.97% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026021 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026934 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026947 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1229013293 | 3300000956 | Soil | SGGKLPDGIPEAARGQLAATLRRDADGLTAITITGQPGR* |
| JGI12269J14319_100345024 | 3300001356 | Peatlands Soil | DLAASGGNLPDGVPEAARGELAAALRRDADGLITVTATA* |
| F14TB_1026355131 | 3300001431 | Soil | AADLAANGGNLPDGIPETARSQLAATLRRDADGLSAITTTD* |
| Ga0070708_1013242311 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ISNAADLAASGGNLPDGVPEAARGELAAALRRDADGLITITTTA* |
| Ga0066701_106457461 | 3300005552 | Soil | NGGKLPDGIPEPARNQLAATLRRDADGLIAITATE* |
| Ga0066661_106905152 | 3300005554 | Soil | ARYISGAADLAASGGKLPDGIPETARNQLAATLRRDADGLIAITTTG* |
| Ga0075029_1008971891 | 3300006052 | Watersheds | RYISGAADLAADGGKLPDGVPETARNQLVATLRRDADGLIAITATG* |
| Ga0075017_1009957394 | 3300006059 | Watersheds | SGAADLAANGGKLPDGIPETARNQLAATLRRDADGLIAITTTE* |
| Ga0075030_1009887542 | 3300006162 | Watersheds | GAADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITATD* |
| Ga0074050_120177051 | 3300006577 | Soil | DLAANGGKLPDGIPETARSQLAGTLRRDADGLIAITTTD* |
| Ga0074064_115270911 | 3300006603 | Soil | ISGAADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITTTD* |
| Ga0066710_1028183971 | 3300009012 | Grasslands Soil | GAADLAANGGKLPDGIPETARSKLAATLRRDADGLTALTAAG |
| Ga0099829_106548341 | 3300009038 | Vadose Zone Soil | NGGKLPDGIPETARSQLAATLRRDADGLIAITTTD* |
| Ga0099829_110604362 | 3300009038 | Vadose Zone Soil | SGAAGLAASGGKLPDGIPETARSQLAATLRRDADGLMAITTTD* |
| Ga0099828_103677011 | 3300009089 | Vadose Zone Soil | AASGGNLPDGVPEAARGELAAALRRDADGLITVTTTA* |
| Ga0116214_10538871 | 3300009520 | Peatlands Soil | NGGKLPDGIPETARNQLAATLRRDADGLIAITTRDS* |
| Ga0116222_12990691 | 3300009521 | Peatlands Soil | DLAANGGKLPDGIPETARSQLAATLRRDADGLIAITATG* |
| Ga0116218_14171461 | 3300009522 | Peatlands Soil | DLAANGGKLPDGIPETARSQLAATLRRDADGLIAITATE* |
| Ga0116221_13138512 | 3300009523 | Peatlands Soil | GKLPDGIPETARHQLAATLRRDADGLIAITTRDS* |
| Ga0116224_105040692 | 3300009683 | Peatlands Soil | YISGAADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITATD* |
| Ga0116216_107358281 | 3300009698 | Peatlands Soil | DLAASGGNLPDGVPEAARGELAAALRRDADGLITVTTTA* |
| Ga0134062_107902011 | 3300010337 | Grasslands Soil | SGGKLPDGIPEAARGQLAATLRRDADGLTAITITGQPGH* |
| Ga0136449_1005843723 | 3300010379 | Peatlands Soil | AASGGNLPDGVPEAARGELAAALRRDADGLITVTATA* |
| Ga0126361_113065161 | 3300010876 | Boreal Forest Soil | AAAADLAAGGGRLPDGIPETARSQLAATLRRDADGLTAITTAC* |
| Ga0151490_17573891 | 3300011107 | Soil | LAANGGKLPDGIPETARNQLAATLRRDADGLIAITAAG* |
| Ga0137388_108177362 | 3300012189 | Vadose Zone Soil | AASGGNLPDGIPEAARDELAAALRRDADRLITISTDT* |
| Ga0137363_104059781 | 3300012202 | Vadose Zone Soil | AANGGKLPDGIPETARSQLAASLRRDADGLIAIATTD* |
| Ga0137380_106979221 | 3300012206 | Vadose Zone Soil | LAASGGNLPDGVPEAARGELAAALRRDADGLITITTTA* |
| Ga0137381_115262762 | 3300012207 | Vadose Zone Soil | AAGLAASGGNLPDGVPEAARGELAAALRRDADGLITITTTA* |
| Ga0137378_107719712 | 3300012210 | Vadose Zone Soil | HIGNAAGLAASGGNLPDGVPEAARGELAAALRRDADGLITVTTTA* |
| Ga0137378_109115112 | 3300012210 | Vadose Zone Soil | NGGKLPDGIPETARNQLAATLRRDADGLIAITTTD* |
| Ga0137372_102729062 | 3300012350 | Vadose Zone Soil | ANGGKLPDGIPETARNQLAATLRRDADGLIAITTTD* |
| Ga0137386_111460721 | 3300012351 | Vadose Zone Soil | ISGAADLAASGGKLPDGIPETARSQLAATLRRDADGLIAIAITTTD* |
| Ga0137371_108040141 | 3300012356 | Vadose Zone Soil | AADLAANGGNLPDGIPETARNQLAATLRRDADGLIAITTTD* |
| Ga0137360_116807581 | 3300012361 | Vadose Zone Soil | ISNAAGLAASGGNLPDGVPEAARGELAAALRRDAGGLITVTATA* |
| Ga0137373_106275101 | 3300012532 | Vadose Zone Soil | RYISGAADLAASGGRLPNGIPETARSQLAATLRRDADGLIAITTTD* |
| Ga0137416_106588883 | 3300012927 | Vadose Zone Soil | AARYISNAADLAASGGNLPDGVPEAARDELAAALRRDADSLITISADA* |
| Ga0182036_118218971 | 3300016270 | Soil | ADLAANGGKLPDGVPEAARGELAATLRRDADGLIAVITTA |
| Ga0182036_119219272 | 3300016270 | Soil | ADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITNMAID |
| Ga0182033_100181084 | 3300016319 | Soil | AANGGKLPDGIPETARSQLAATLRRDADGLIAVTAAG |
| Ga0182035_110173621 | 3300016341 | Soil | AADLAANGGKLPDGIPETARNQLAATLRRDADGLIAITTTG |
| Ga0182034_111250222 | 3300016371 | Soil | LAANGGKLPDGIPETARNQLGASLRRDADGLIAITTTE |
| Ga0182039_108766312 | 3300016422 | Soil | AADLAANGGHLPDGIPEAARTQLAASLRRDADGLIAITTTD |
| Ga0187806_10076417 | 3300017928 | Freshwater Sediment | ARYISGAADLAANGGRLPDGIPETARSQLAASLRRDADGLIAIITG |
| Ga0187806_12048352 | 3300017928 | Freshwater Sediment | DLAANGGELPDGIPETARDQLAATLRRDADGLIAIADAG |
| Ga0187817_100225696 | 3300017955 | Freshwater Sediment | YISGAADLAANGGKLPDGIPETARNQLAATLRRDADGLIAIAITTTD |
| Ga0187817_105230091 | 3300017955 | Freshwater Sediment | AADLAASGGKLPGRDSRDGTRPAAATLRRDADGLIAITTTG |
| Ga0187778_112561721 | 3300017961 | Tropical Peatland | SGAADLAANGGNLPDGIPETARSQLAATLRRDADGLIAITATG |
| Ga0187777_108987181 | 3300017974 | Tropical Peatland | LAANGGKLPDGIPETARSQLAATLRRDADGLIAITTRDS |
| Ga0187782_110772351 | 3300017975 | Tropical Peatland | SAADLAANGGQLPDGVPETARSQLAATLRRDADGLIAITTTG |
| Ga0187810_104675431 | 3300018012 | Freshwater Sediment | AADLAANGGKLPDGIPETARSQLAATLRRDADGLTAITATD |
| Ga0187855_108101142 | 3300018038 | Peatland | DLAADGGKLPDGIPETARNQLAATLRRDADRLIAITATD |
| Ga0187766_100265815 | 3300018058 | Tropical Peatland | NGGKLPDGIPETARSQLAATLRRDADGVVAITATG |
| Ga0187766_110861302 | 3300018058 | Tropical Peatland | AADLAANGGKLPDGIPGTARSQLAATLRRDADGLIAITATG |
| Ga0187765_104281232 | 3300018060 | Tropical Peatland | AANGGKLPDGVPETARSQLAATLRRDAERLTALTAAG |
| Ga0187769_110666682 | 3300018086 | Tropical Peatland | GAADLAANGGKLPDGIPETARNQLAATLRRDADGLIAITTTG |
| Ga0066669_111290652 | 3300018482 | Grasslands Soil | GKLPDGIPEAARGQLAATLRRDADGLTAITITGQPGH |
| Ga0210399_103604034 | 3300020581 | Soil | SGGKLPDGIPEAARGQLAATLRRNADGLTAITVTG |
| Ga0210384_100434321 | 3300021432 | Soil | GGKLPDGIPEAARGQLAATLRRDADGLTAITITGQPGH |
| Ga0210384_106508473 | 3300021432 | Soil | LAASGGKLPDGIPEAARGQLAATLRRDADGLTAITITG |
| Ga0207692_111914791 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AADLAANGGKLPAGIPETARSQLAATLRRDADGLTAITATG |
| Ga0207684_113993502 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | NGGKLPDGIPETARSQLAATLRRDADGLVAITTTD |
| Ga0208140_10213991 | 3300026021 | Rice Paddy Soil | YISNAADLAANGGKLPDGVPEAARGELAATLRRDADGLIAVTTTA |
| Ga0209131_10359062 | 3300026320 | Grasslands Soil | MTDTAKSAAADLAASGGNLPDGVPEAARDELAAALRRHADRLITISADV |
| Ga0207816_10451571 | 3300026934 | Tropical Forest Soil | ADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITGTG |
| Ga0207853_10419691 | 3300026947 | Tropical Forest Soil | ARYISGAADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITGTG |
| Ga0209590_104087971 | 3300027882 | Vadose Zone Soil | DLAANGGKLPDGIPETARNQLAATLRRDADGLIAITTTD |
| Ga0209068_108345791 | 3300027894 | Watersheds | DPVSADLAANGGKLPDGIPETARNQLAATLRRDADGLIAITTTG |
| Ga0209415_110686571 | 3300027905 | Peatlands Soil | GAADLAANGGKLPDGIPETARNQLAATLRRDADGLIAITTRDS |
| Ga0310037_100698183 | 3300030494 | Peatlands Soil | DLAASGGNLPDGVPEAARGELAAALRRDADGLITVTTTA |
| Ga0311356_115727991 | 3300030617 | Palsa | YISGTADLAANGGKLPDGIPETARHQLVATLRRDADGLTAITAAD |
| Ga0318571_104187752 | 3300031549 | Soil | GGKLPAGIPETARNQLAATLRRDADGLIAIAIAATD |
| Ga0318573_101902841 | 3300031564 | Soil | ANGGHLPAGIPEAARTQLAATLRRDADGLIAITATG |
| Ga0318555_105147571 | 3300031640 | Soil | LAANGGKLPDGIPETARSQLAATLRRDADGLTAITDAG |
| Ga0307372_102082874 | 3300031671 | Soil | SAADLAASGGNLPDGVPEAARGELAAALRRDADGLITVTTTA |
| Ga0310686_1164715851 | 3300031708 | Soil | LAASGGNLPDGVPEAARDELAAALRRDADRLIAVTTTA |
| Ga0318496_105661491 | 3300031713 | Soil | ARYISGAADLTANGGQFPDGIPETARSQLAATLRRDADGLIAITTAD |
| Ga0318498_105301541 | 3300031778 | Soil | YIGGAADLAANGKLPDGIPETARSQLAATLRRDADGLIAITTTG |
| Ga0318529_102938032 | 3300031792 | Soil | ANGGKLPDGIPETARSQLAATLRRDADGLIAVTAAG |
| Ga0318576_103650902 | 3300031796 | Soil | RYISGAADLAANGGKLPDGIPETARHQLAATLRRDADGLTALTAAG |
| Ga0318550_101821591 | 3300031797 | Soil | RYIGGAADLAANGGHLPDGIPEAARTQLAASLRRDADGLIAITTTD |
| Ga0306921_118922302 | 3300031912 | Soil | YISGAADLVANGGKLPDGIPETARNQLAATLRRDANGLIAIAIAATD |
| Ga0310913_111226301 | 3300031945 | Soil | ISDAADLAANGGNLPDGIPETARNQLAATLRRDADGLIAITTTG |
| Ga0306922_100612785 | 3300032001 | Soil | ANGGHLPDGIPEAARTQLAASLRRDADGLIAITTTD |
| Ga0311301_1000869137 | 3300032160 | Peatlands Soil | YIGNAADLAASGGNLPDGVPEAARGELAAALRRDADGLITVTTTA |
| Ga0311301_108098602 | 3300032160 | Peatlands Soil | RYISNAADLAGSGGNLPDGVPEAARGELAAALRRDADRLITVTTTA |
| Ga0311301_113268482 | 3300032160 | Peatlands Soil | AGGKLPDGIPETARSQLAATLRRDADGLIAITTTD |
| Ga0311301_118974362 | 3300032160 | Peatlands Soil | YISGAADLAANGGKLPDGIPETARNQLAATLRRDADGLIAITTTG |
| Ga0306920_1006095674 | 3300032261 | Soil | ANGGKLPDGIPETARSQLAATLRRDADGLIAITTG |
| Ga0335079_109582031 | 3300032783 | Soil | GAADLAANGGKLPDGISETARSQLAATLRRDADGLIAITTRDS |
| Ga0335078_107737252 | 3300032805 | Soil | WYRGGAADLAMNGGQLPEGIPETARSQLAATLRRDADGLIAITAAD |
| Ga0335078_110048131 | 3300032805 | Soil | DLAASGGKLPDGIPEAARGQLAATLRRDADGLTAITITGQPGH |
| Ga0335080_101165036 | 3300032828 | Soil | IGGAADLAANGGNLPDGVPETARSQLAATLRRDADGLIAITTTG |
| Ga0335080_107398341 | 3300032828 | Soil | ADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITTTD |
| Ga0335080_114194382 | 3300032828 | Soil | YISGAADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITARDS |
| Ga0335080_119125342 | 3300032828 | Soil | GAADLAANDGKLPDGIPETARNQLAATLRRDADGLIAITTTE |
| Ga0335070_112151671 | 3300032829 | Soil | ASGGKLPDGIPEAARGQLAATLRRDADGLTAITITGQPGH |
| Ga0335081_100988411 | 3300032892 | Soil | AADLAANGGNLPDGVPETARSQLAATLRRDADGLIAITTTG |
| Ga0335081_101636495 | 3300032892 | Soil | ANGGKLPDGIPETARSQLAATLRRDADGLIAITATD |
| Ga0335074_114521332 | 3300032895 | Soil | RAANGGRLPDGIPETARSQLAASLRRDADGLIAIITG |
| Ga0335071_111795031 | 3300032897 | Soil | KLPDGIPEAARGQLAATLRRDADGLTAITITGQPGH |
| Ga0335076_101224021 | 3300032955 | Soil | DGKLPAGIPETARSQLAATLRRDADGLTAITITGQPGH |
| Ga0335077_118145831 | 3300033158 | Soil | AADLAANGGKLPDGIPETARSQLAATLRRDADGLIAITTTD |
| ⦗Top⦘ |