


| Basic Information | |
|---|---|
| Family ID | F099834 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ARRRGTALPRFSVEAYRRINSAEAHLVVLIVFVAAFMARGAWLF |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.88 % |
| % of genes near scaffold ends (potentially truncated) | 93.20 % |
| % of genes from short scaffolds (< 2000 bps) | 91.26 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.786 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.738 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.573 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF09980 | DUF2214 | 9.71 |
| PF00027 | cNMP_binding | 3.88 |
| PF08281 | Sigma70_r4_2 | 2.91 |
| PF02086 | MethyltransfD12 | 2.91 |
| PF02518 | HATPase_c | 2.91 |
| PF13185 | GAF_2 | 2.91 |
| PF13432 | TPR_16 | 1.94 |
| PF06965 | Na_H_antiport_1 | 1.94 |
| PF00583 | Acetyltransf_1 | 1.94 |
| PF02397 | Bac_transf | 1.94 |
| PF04069 | OpuAC | 1.94 |
| PF08450 | SGL | 1.94 |
| PF07676 | PD40 | 1.94 |
| PF07883 | Cupin_2 | 1.94 |
| PF07394 | DUF1501 | 1.94 |
| PF00106 | adh_short | 0.97 |
| PF00196 | GerE | 0.97 |
| PF00795 | CN_hydrolase | 0.97 |
| PF03551 | PadR | 0.97 |
| PF05235 | CHAD | 0.97 |
| PF00275 | EPSP_synthase | 0.97 |
| PF00127 | Copper-bind | 0.97 |
| PF11578 | DUF3237 | 0.97 |
| PF02922 | CBM_48 | 0.97 |
| PF04542 | Sigma70_r2 | 0.97 |
| PF03781 | FGE-sulfatase | 0.97 |
| PF02771 | Acyl-CoA_dh_N | 0.97 |
| PF00486 | Trans_reg_C | 0.97 |
| PF13620 | CarboxypepD_reg | 0.97 |
| PF05163 | DinB | 0.97 |
| PF00005 | ABC_tran | 0.97 |
| PF01590 | GAF | 0.97 |
| PF13692 | Glyco_trans_1_4 | 0.97 |
| PF08002 | DUF1697 | 0.97 |
| PF02321 | OEP | 0.97 |
| PF13450 | NAD_binding_8 | 0.97 |
| PF12704 | MacB_PCD | 0.97 |
| PF02687 | FtsX | 0.97 |
| PF07730 | HisKA_3 | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF13231 | PMT_2 | 0.97 |
| PF00326 | Peptidase_S9 | 0.97 |
| PF10518 | TAT_signal | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 2.91 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 2.91 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.94 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 1.94 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.94 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.94 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.94 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.97 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.97 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.97 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.97 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.97 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.97 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.97 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.97 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.97 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.97 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.79 % |
| Unclassified | root | N/A | 26.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_12979446 | Not Available | 631 | Open in IMG/M |
| 3300001431|F14TB_100688107 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300004463|Ga0063356_100986366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
| 3300004463|Ga0063356_102921042 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005179|Ga0066684_10288973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300005330|Ga0070690_100419569 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005332|Ga0066388_106635522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300005364|Ga0070673_100194188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1745 | Open in IMG/M |
| 3300005364|Ga0070673_101127426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas gingeri | 733 | Open in IMG/M |
| 3300005451|Ga0066681_10651501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300005467|Ga0070706_101633107 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005467|Ga0070706_101929243 | Not Available | 536 | Open in IMG/M |
| 3300005471|Ga0070698_100031884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5462 | Open in IMG/M |
| 3300005518|Ga0070699_101195052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300005560|Ga0066670_10194289 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300005576|Ga0066708_10812485 | Not Available | 586 | Open in IMG/M |
| 3300005598|Ga0066706_10589450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300005617|Ga0068859_101053366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300005764|Ga0066903_103495129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp. | 847 | Open in IMG/M |
| 3300005764|Ga0066903_107635009 | Not Available | 557 | Open in IMG/M |
| 3300005842|Ga0068858_102592715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300005843|Ga0068860_102047289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Armatimonadales → Armatimonadaceae → Armatimonas → Armatimonas rosea | 594 | Open in IMG/M |
| 3300005844|Ga0068862_102085346 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006169|Ga0082029_1126847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300006358|Ga0068871_100620346 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300006796|Ga0066665_10611470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300006852|Ga0075433_10595010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14 | 971 | Open in IMG/M |
| 3300006854|Ga0075425_100799164 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300007076|Ga0075435_100035974 | All Organisms → cellular organisms → Bacteria | 3932 | Open in IMG/M |
| 3300007076|Ga0075435_100384882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9 | 1205 | Open in IMG/M |
| 3300007258|Ga0099793_10646885 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009100|Ga0075418_10083004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3408 | Open in IMG/M |
| 3300009137|Ga0066709_103392667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 579 | Open in IMG/M |
| 3300009148|Ga0105243_11593166 | Not Available | 679 | Open in IMG/M |
| 3300009148|Ga0105243_12195688 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009162|Ga0075423_10985630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300009162|Ga0075423_11780592 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009176|Ga0105242_10097652 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300009176|Ga0105242_10102985 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
| 3300009553|Ga0105249_11066375 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300009610|Ga0105340_1437760 | Not Available | 584 | Open in IMG/M |
| 3300009803|Ga0105065_1049136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300010036|Ga0126305_10614031 | Not Available | 732 | Open in IMG/M |
| 3300010037|Ga0126304_10798271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hirsutus | 640 | Open in IMG/M |
| 3300010039|Ga0126309_11166408 | Not Available | 527 | Open in IMG/M |
| 3300010043|Ga0126380_11660714 | Not Available | 572 | Open in IMG/M |
| 3300010166|Ga0126306_10618973 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300010323|Ga0134086_10172384 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300010333|Ga0134080_10439103 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300010358|Ga0126370_10324892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300010362|Ga0126377_11376527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300010366|Ga0126379_13882640 | Not Available | 500 | Open in IMG/M |
| 3300010398|Ga0126383_10789952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300010398|Ga0126383_11667272 | Not Available | 727 | Open in IMG/M |
| 3300010398|Ga0126383_12075969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 655 | Open in IMG/M |
| 3300010399|Ga0134127_11841057 | Not Available | 682 | Open in IMG/M |
| 3300010401|Ga0134121_11795776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300011270|Ga0137391_10431279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300012210|Ga0137378_11403750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300012354|Ga0137366_10315828 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300012357|Ga0137384_10427134 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300012362|Ga0137361_11195410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012363|Ga0137390_10321174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1529 | Open in IMG/M |
| 3300012469|Ga0150984_113226005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012922|Ga0137394_10296146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 1383 | Open in IMG/M |
| 3300012971|Ga0126369_11417874 | Not Available | 785 | Open in IMG/M |
| 3300014326|Ga0157380_12413344 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300014965|Ga0120193_10070458 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300015200|Ga0173480_10333775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 859 | Open in IMG/M |
| 3300015358|Ga0134089_10489409 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300015371|Ga0132258_10211649 | All Organisms → cellular organisms → Bacteria | 4710 | Open in IMG/M |
| 3300015371|Ga0132258_12340647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
| 3300015373|Ga0132257_104467648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300016341|Ga0182035_11123542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300016422|Ga0182039_11215019 | Not Available | 681 | Open in IMG/M |
| 3300018027|Ga0184605_10527509 | Not Available | 511 | Open in IMG/M |
| 3300025899|Ga0207642_11163759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300025910|Ga0207684_10983177 | Not Available | 707 | Open in IMG/M |
| 3300025922|Ga0207646_11412736 | Not Available | 605 | Open in IMG/M |
| 3300025934|Ga0207686_10042268 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
| 3300025942|Ga0207689_10587631 | Not Available | 936 | Open in IMG/M |
| 3300025942|Ga0207689_11523500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300026075|Ga0207708_10670714 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300026142|Ga0207698_12016944 | Not Available | 591 | Open in IMG/M |
| 3300027903|Ga0209488_10609041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300028379|Ga0268266_10828558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300028812|Ga0247825_10000119 | All Organisms → cellular organisms → Bacteria | 43916 | Open in IMG/M |
| 3300031547|Ga0310887_10229382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1026 | Open in IMG/M |
| 3300031547|Ga0310887_11014780 | Not Available | 530 | Open in IMG/M |
| 3300031562|Ga0310886_10813781 | Not Available | 589 | Open in IMG/M |
| 3300031682|Ga0318560_10387221 | Not Available | 756 | Open in IMG/M |
| 3300031770|Ga0318521_10980288 | Not Available | 518 | Open in IMG/M |
| 3300031794|Ga0318503_10010439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2428 | Open in IMG/M |
| 3300031854|Ga0310904_10226384 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300031894|Ga0318522_10086299 | Not Available | 1151 | Open in IMG/M |
| 3300031910|Ga0306923_11584536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300031942|Ga0310916_11398618 | Not Available | 573 | Open in IMG/M |
| 3300031947|Ga0310909_10261632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1447 | Open in IMG/M |
| 3300032052|Ga0318506_10220976 | Not Available | 837 | Open in IMG/M |
| 3300032076|Ga0306924_11626879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300032180|Ga0307471_100356325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1575 | Open in IMG/M |
| 3300032261|Ga0306920_101559621 | Not Available | 941 | Open in IMG/M |
| 3300033482|Ga0316627_101529827 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.97% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_129794461 | 3300000550 | Soil | IRVRAARRSGQPLPRFPLEAYRRINSVEIALVVIIVIVAAFMARGAWLF* |
| F14TB_1006881073 | 3300001431 | Soil | ITFIRVRSARRNRTALPAFSVDAYRTINSVEIALVVTIVFVAAFMARGAWLF* |
| Ga0063356_1009863663 | 3300004463 | Arabidopsis Thaliana Rhizosphere | APMTTFIRIRAARRGGAPLPSFPLAVYRRINAVEGMLLVAIVFAAAFMARGAWLF* |
| Ga0063356_1029210421 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PMMTFMRVRSARRRRAALPQFPVEAYRRINSAEIVLVVAIVFAAAFMVRGVWLF* |
| Ga0066684_102889731 | 3300005179 | Soil | MRNGTTLPQFPVAVFRRINSAEIALVIAIVFTAAFMARGAWLF* |
| Ga0070690_1004195692 | 3300005330 | Switchgrass Rhizosphere | NRLAEHFLLELAPMTTFVRVRLARARGAPLPPFSIDSCRRVNAVELGLVVAIVFVAAFMARAAWMF* |
| Ga0066388_1066355222 | 3300005332 | Tropical Forest Soil | RRQHAELPRFNVQVYAGINTAEVALVVTIVFVAAFMARGVWLF* |
| Ga0070673_1001941883 | 3300005364 | Switchgrass Rhizosphere | KHHTPLPRFSVEIYRRINSVELALVVTIVFVAAFMARGAWLF* |
| Ga0070673_1011274261 | 3300005364 | Switchgrass Rhizosphere | MTFIRVRVARKRGSPLPLFSVEVYRRINRAEVVLVAAIVIVAAFMARGAWLF* |
| Ga0066681_106515011 | 3300005451 | Soil | KTALPRFSAESLRRINSAETILVVAIVFIAAFMARGAWMF* |
| Ga0070706_1016331071 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TFIRVRSARSRHTPLPDFPLDVYRRINTAETALVIAIVFVAAFMARGAWLF* |
| Ga0070706_1019292431 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGAPLPPFPLATYRRINAAETALVVVIVFVAAFMARGAWML* |
| Ga0070698_1000318841 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RRQGVPFPPFPLATYRRINAVETALVVVIVFVAAFMARGAWML* |
| Ga0070699_1011950521 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSKGMPVPRFPIDAYRRINAIELALVVAIVFVAAFMARGAWLF* |
| Ga0066670_101942892 | 3300005560 | Soil | MITFVRVRIARRKGLAPPAFSIETYRRINAVETALLVAIVFVAAFMARGAWLF* |
| Ga0066708_108124851 | 3300005576 | Soil | RRRGTALPRFPVEAYCRINSAEIVLVVAIVFAAAFTARGAWLF* |
| Ga0066706_105894501 | 3300005598 | Soil | MFIRVRLARRRSTALPHFSVEAYRRINAAELLLVVIIVFVAAFMARGAWLF* |
| Ga0068859_1010533662 | 3300005617 | Switchgrass Rhizosphere | PRFSVEAYRRINTAEIVLVVAIVFAAAFMARGAWLF* |
| Ga0066903_1034951291 | 3300005764 | Tropical Forest Soil | MMTFIRVRRARSKRLAVPHFPIETYRRINAAELALVIAIVIVAAFMARGAWLF* |
| Ga0066903_1076350092 | 3300005764 | Tropical Forest Soil | PKFPLDIYRRINAVELWLVVAIVFVAAFMARGAWMF* |
| Ga0068858_1025927151 | 3300005842 | Switchgrass Rhizosphere | TALPRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF* |
| Ga0068860_1020472891 | 3300005843 | Switchgrass Rhizosphere | TALARGAALPEFPLGAYRRMNSGEVALVVAIVFVAAFMARGAWLF* |
| Ga0068862_1020853461 | 3300005844 | Switchgrass Rhizosphere | VRIARSKGLPLPRFSVEAYRRINAVEAGLVVIIVFAAAFMARGAWLF* |
| Ga0082029_11268471 | 3300006169 | Termite Nest | KRGLSFPPLPIESLRRINRAEMALVVIIVVVAAFMARGAWLLS* |
| Ga0068871_1006203462 | 3300006358 | Miscanthus Rhizosphere | TFMRVRAARRRKTELPRFSVETYSAINTAEVVLVITIVFVAAFMARGAWLF* |
| Ga0066665_106114702 | 3300006796 | Soil | PRFSLDAYRRINAAEVTLIVAIVFVAAFMARGAWLF* |
| Ga0075433_105950101 | 3300006852 | Populus Rhizosphere | TFIRVRSARRRNAPLPRFSIEALGRINALELGIVVAIVFVAAFMARGAWLF* |
| Ga0075425_1007991641 | 3300006854 | Populus Rhizosphere | KKSAPLPGFPVETFRRINSAETALVVIIVFVAAFMARGAWLF* |
| Ga0075435_1000359746 | 3300007076 | Populus Rhizosphere | PMATFVRVRAARRKGLPAPPFPVETYRRINAAELGLVVAIVVVAALMARGAWLF* |
| Ga0075435_1003848821 | 3300007076 | Populus Rhizosphere | RGRAAPLPRFSAETLRRINAAEVVLVVLIVFVAAFMARGAWLF* |
| Ga0099793_106468852 | 3300007258 | Vadose Zone Soil | TALPRFSAEAYRRINSAEVILVVTIVFVAAFMARGAWLF* |
| Ga0075418_100830045 | 3300009100 | Populus Rhizosphere | AAIPRFSAARYRVLNTIELALVVSIVFVAALMTRGAWLF* |
| Ga0066709_1033926671 | 3300009137 | Grasslands Soil | RAAPLPRFSAETFRRINAAETELVVLIVFVAAFMARGAWLF* |
| Ga0105243_115931662 | 3300009148 | Miscanthus Rhizosphere | LEPSSLAGARRHQTALPRFSLETYRRINSAEMILVVAIVFVAAFMARGAWLF* |
| Ga0105243_121956882 | 3300009148 | Miscanthus Rhizosphere | ALPRFSVDAFRRINAAELALVVAIVFVAAFMARGAWLF* |
| Ga0075423_109856301 | 3300009162 | Populus Rhizosphere | RAARRRRAALPRFSVEAYRRINSAEMILVVAIVFVAAFMARGAWLF* |
| Ga0075423_117805922 | 3300009162 | Populus Rhizosphere | MMTFIRVRIAVARRMPLPRFSVETYRRINTAETALVVAIVFVAAFMARGVWLF* |
| Ga0105242_100976521 | 3300009176 | Miscanthus Rhizosphere | ARRGGKPLPDFSVARYRRINTAAAVLVIAIVFVAAFMARGAWLF* |
| Ga0105242_101029855 | 3300009176 | Miscanthus Rhizosphere | PRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF* |
| Ga0105249_110663752 | 3300009553 | Switchgrass Rhizosphere | TFIRVRNARAKRTVLPRFPLDTYRRINAAELALVITIVFMAAFMARGAWMF* |
| Ga0105340_14377601 | 3300009610 | Soil | MITFIRVRTARSKGSPLPKFSVEAYRRINAVELGLVVTIVFAAAFMARGAWLF* |
| Ga0105065_10491362 | 3300009803 | Groundwater Sand | QGVTVPQFSVDAYRRINAVELALVVTIVFVAAFMARGAWLF* |
| Ga0126305_106140311 | 3300010036 | Serpentine Soil | TTFIRVRAARRRGSPLPSFSIEAYRRINIAETTLVVVIVFVAAFMARGAWLF* |
| Ga0126304_107982711 | 3300010037 | Serpentine Soil | RGSSPPTVPVDACRRINHIETALVVVIVFVAAFIARGAWLF* |
| Ga0126309_111664082 | 3300010039 | Serpentine Soil | RTAWPRFPVETYRRINSAELVLVVIIVFVAAFMARGAWLF* |
| Ga0126380_116607141 | 3300010043 | Tropical Forest Soil | PMTTFMRVRRARRQKTALPQFPLDMYRRINKVEFGLVVTIVFVAAFMTRGAWMF* |
| Ga0126306_106189731 | 3300010166 | Serpentine Soil | MTTFIRVRAARRRGSPLPSFSIEAYRRINIAETTLVVVIVFVAAFMARGAWLF* |
| Ga0134086_101723842 | 3300010323 | Grasslands Soil | ALPRFPVEAYCRINSAEIVLVVAIVFAAAFMARGAWLF* |
| Ga0134080_104391031 | 3300010333 | Grasslands Soil | IRVRRARSHGVAVPRFSIEAYRRINAAELALVVTIVFVAAFMARGAWLF* |
| Ga0126370_103248921 | 3300010358 | Tropical Forest Soil | RVRIAQSRGTAIPRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF* |
| Ga0126377_113765271 | 3300010362 | Tropical Forest Soil | MVTFIRVRSARALKAPPPRFRVETFRTINTIELALVVAIVFVAAFMARAAWLF* |
| Ga0126379_138826402 | 3300010366 | Tropical Forest Soil | FMRVRIAQSRGTAIPRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF* |
| Ga0126383_107899521 | 3300010398 | Tropical Forest Soil | PRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF* |
| Ga0126383_116672721 | 3300010398 | Tropical Forest Soil | TFVRVRAARRNRAALPAFSVEAYRTINSVEIALVVAIVFVAAFMARGAWMF* |
| Ga0126383_120759691 | 3300010398 | Tropical Forest Soil | MILLPRFSIETYRRINGIEERLVVSIVFVAAFMARGAWLF* |
| Ga0134127_118410572 | 3300010399 | Terrestrial Soil | ELAPMVAFIRVRIARKRGLPLPRFSVYTFRRINQAETVLIMVIVIVAAFMVRGTWLF* |
| Ga0134121_117957762 | 3300010401 | Terrestrial Soil | ARRRGTALPRFSVEAYRRINSAEAHLVVLIVFVAAFMARGAWLF* |
| Ga0137391_104312791 | 3300011270 | Vadose Zone Soil | AREPRAARGAPMPEFSVEAYRRINAVEVVPVVAIVFVAAFMARGAWLF* |
| Ga0137378_114037501 | 3300012210 | Vadose Zone Soil | TALPRFPLDAFRRINSAEIVLVVAIVFVAAFMARGAWLF* |
| Ga0137366_103158283 | 3300012354 | Vadose Zone Soil | MIFIRVRLARTRRTALPRFSVEAYRRINAAELVLVVIIVFVAAFMARGAWLF* |
| Ga0137384_104271342 | 3300012357 | Vadose Zone Soil | RFSVKAYRRINSAELVLVVVIVFVAAFMARGAWLF* |
| Ga0137361_111954102 | 3300012362 | Vadose Zone Soil | IRVRAARRRHTASPRFSIATYRRINAAEVVLVVAIVFAAAFMARGAWLF* |
| Ga0137390_103211741 | 3300012363 | Vadose Zone Soil | RFSVDAYRRINAAEVALVVAIVFVAAFMARGAWLF* |
| Ga0150984_1132260052 | 3300012469 | Avena Fatua Rhizosphere | FRSLARSRGTALPPFSIESYRRINAAELGLVVAIVFVAAFMARGAWLF* |
| Ga0137394_102961462 | 3300012922 | Vadose Zone Soil | MPMMSFIRVRAARRRHTALPRFSIATYRRINAAEVVLVVAIVFAAAFMARGAWLF* |
| Ga0126369_114178741 | 3300012971 | Tropical Forest Soil | RRRGTPLPQFSVAVYRRINALELALVVTIVFVAAFMARGAWLF* |
| Ga0157380_124133442 | 3300014326 | Switchgrass Rhizosphere | LPRFSVEIYRRINSVELALVVTIVFVAAFMARGAWLF* |
| Ga0120193_100704582 | 3300014965 | Terrestrial | GAPLPPVPVAMYRRINAVETALVFLIVIVAAFMARGAWMI* |
| Ga0173480_103337752 | 3300015200 | Soil | GLPLPRFSVEAYRRINAVEAGLVVIIVFAAAFMARGAWLF* |
| Ga0134089_104894091 | 3300015358 | Grasslands Soil | PMTTFIRVRAALGRKTALPRFSAESLRRINSAETILVVAIVFIAALMARGSWMF* |
| Ga0132258_102116492 | 3300015371 | Arabidopsis Rhizosphere | MVTFIRVRQARRRGSALPRFSVNACRRINNVEVALVVAIVFVAAFMARGAWLF* |
| Ga0132258_123406471 | 3300015371 | Arabidopsis Rhizosphere | MRARTARVRGVALPRFSIVAYQRINAVELALVVAIVFVAAFMARGAWLF* |
| Ga0132257_1044676482 | 3300015373 | Arabidopsis Rhizosphere | RRKALPRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF* |
| Ga0182035_111235421 | 3300016341 | Soil | MRVRVAQSRGTAIPRFPIETYRRINAAELGLVVAIVFVAAFMARGAWLF |
| Ga0182039_112150192 | 3300016422 | Soil | PRFPVEAYRRINEIELALVIAIVFVAAFMARGAWLF |
| Ga0184605_105275091 | 3300018027 | Groundwater Sediment | RALPRFSVGTYRRINSAELVLVVTIVFVAAFMARGAWLF |
| Ga0207642_111637591 | 3300025899 | Miscanthus Rhizosphere | RRSTALPRFSVEAYRRINTAEIVLVVAIVFAAAFMARGAWLF |
| Ga0207684_109831772 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RSARRQGVPFPFPLATYRRINAVETALVVVIVFVAAFMARGAWML |
| Ga0207646_114127361 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VARRMPLPRFSAETYRRINTAETALVVAIVFVAAFMARGLWLF |
| Ga0207686_100422685 | 3300025934 | Miscanthus Rhizosphere | RTALPRFSVEAYRRINTAEIVLVVAIVFAAALMARGAWLF |
| Ga0207689_105876311 | 3300025942 | Miscanthus Rhizosphere | LPLFSVEVYRRINRAEVVLVAAIVIVAAFMARGAWLF |
| Ga0207689_115235001 | 3300025942 | Miscanthus Rhizosphere | LPRFSNDLFRRINAAEVTLVVGIVFVAAFMARGTWLF |
| Ga0207708_106707141 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | PMMTFIRVRAARRSGSSLPRFSVETLRRINAAELGLIVAIVFAAAFMARGAWLF |
| Ga0207698_120169441 | 3300026142 | Corn Rhizosphere | SVAAYRRINTAETALLVVIVLVAALMARGAWLFTAFQN |
| Ga0209488_106090411 | 3300027903 | Vadose Zone Soil | VRAARRRHTASPRFSIATYRRINSAEVVLVVAIVFAAAFMARGAWLF |
| Ga0268266_108285581 | 3300028379 | Switchgrass Rhizosphere | RAARGRQTTLPRFSIESLRRINAAELVLVVTIVFVAAFMARGAWLF |
| Ga0247825_1000011922 | 3300028812 | Soil | LPQFSLEAFRLINTVELALVVAIVFVAAFMARGAWLF |
| Ga0310887_102293822 | 3300031547 | Soil | GSPLPKLSVEAYRRINAVELGLVVTIVFAAAFMARGAWLF |
| Ga0310887_110147801 | 3300031547 | Soil | SQAGGAAMPAFDVARYRRINAIEMRLVIAIPFAAALMARGAWLF |
| Ga0310886_108137812 | 3300031562 | Soil | GGAAMPAFDVARYRRINAIEMRLVIAIPFAAALMARGAWLF |
| Ga0318560_103872212 | 3300031682 | Soil | RARSQRSALPRFPVEAYRRINEIELALVIAIVFVAAFMARGAWLF |
| Ga0318521_109802881 | 3300031770 | Soil | MVTFIRVRVARGRGAPPPGFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF |
| Ga0318503_100104394 | 3300031794 | Soil | VRSARRRGEALPRFSVQMFRRINSAEVVLVVTIVFVAAFMARGAWLF |
| Ga0310904_102263842 | 3300031854 | Soil | KRTALPRFPLDTYRRINAAELALVITIVFMAAFMARGAWMF |
| Ga0318522_100862991 | 3300031894 | Soil | RSARRRGEALPRFSVQMFRRINSAEVVLVVTIVLVAAFMARGAWLF |
| Ga0306923_115845361 | 3300031910 | Soil | RVRVARGRGAPPPEFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF |
| Ga0310916_113986182 | 3300031942 | Soil | VARGRGAPPPEFSVQTFRRINSVEVALIVCIVFVAAFMARGAWLF |
| Ga0310909_102616322 | 3300031947 | Soil | APPPEFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF |
| Ga0318506_102209761 | 3300032052 | Soil | FIRVRSARRRGEALPRFSVQMFRRINSAEVVLVVTIVFVAAFMARGAWLF |
| Ga0306924_116268792 | 3300032076 | Soil | TFIRVRVARGRGAPPPEFSVQTFRRINSVEVALVVCIVFVAAFMARGAWLF |
| Ga0307471_1003563254 | 3300032180 | Hardwood Forest Soil | MTTFIRARQARRKHADMPRFPVDIYRRINAAELALVVVIVFVAAFMARGTWLF |
| Ga0306920_1015596212 | 3300032261 | Soil | ALPRFPLAAYRRINAAEVVFVIAIVFAAAFMARGAWLF |
| Ga0316627_1015298271 | 3300033482 | Soil | RTARRRGTALPVFSVDAFRLINSIETALVIAIVFVAAFMARGAWLF |
| ⦗Top⦘ |