


| Basic Information | |
|---|---|
| Family ID | F099818 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLVERRGQVIAVEIGPTGYAGRSPTVQRKAAAFVRWHEPDDARVS |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 49.02 % |
| % of genes near scaffold ends (potentially truncated) | 88.35 % |
| % of genes from short scaffolds (< 2000 bps) | 90.29 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.204 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.621 % of family members) |
| Environment Ontology (ENVO) | Unclassified (14.563 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.660 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 4.85 |
| PF08388 | GIIM | 3.88 |
| PF04392 | ABC_sub_bind | 2.91 |
| PF13458 | Peripla_BP_6 | 0.97 |
| PF00149 | Metallophos | 0.97 |
| PF06736 | TMEM175 | 0.97 |
| PF00107 | ADH_zinc_N | 0.97 |
| PF03480 | DctP | 0.97 |
| PF07992 | Pyr_redox_2 | 0.97 |
| PF05050 | Methyltransf_21 | 0.97 |
| PF00589 | Phage_integrase | 0.97 |
| PF13808 | DDE_Tnp_1_assoc | 0.97 |
| PF00004 | AAA | 0.97 |
| PF00990 | GGDEF | 0.97 |
| PF00574 | CLP_protease | 0.97 |
| PF13683 | rve_3 | 0.97 |
| PF13649 | Methyltransf_25 | 0.97 |
| PF00069 | Pkinase | 0.97 |
| PF13531 | SBP_bac_11 | 0.97 |
| PF09955 | DUF2189 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 4.85 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.88 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.91 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.20 % |
| Unclassified | root | N/A | 6.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301A29L9 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 518 | Open in IMG/M |
| 2170459006|GBPF9FW01AT01K | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
| 2189573005|GZGK9D402HO52B | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 534 | Open in IMG/M |
| 3300001141|JGI12638J13249_102757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300001143|JGI12687J13287_101273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300001204|JGI12652J13314_100904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300001394|JGI20191J14862_1024676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1002 | Open in IMG/M |
| 3300001867|JGI12627J18819_10301019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300001867|JGI12627J18819_10310843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300002568|C688J35102_119293147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300002910|JGI25615J43890_1046847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300003704|Ga0008088_102340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 611 | Open in IMG/M |
| 3300003710|Ga0008089_101152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 570 | Open in IMG/M |
| 3300004471|Ga0068965_1318379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300004593|Ga0068946_1000080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300004615|Ga0068926_1407327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300004964|Ga0072331_1164619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300005186|Ga0066676_10049048 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300005332|Ga0066388_101345817 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300005434|Ga0070709_10344577 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005468|Ga0070707_101095223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 762 | Open in IMG/M |
| 3300005786|Ga0078433_112564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 621 | Open in IMG/M |
| 3300005938|Ga0066795_10216545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 568 | Open in IMG/M |
| 3300006172|Ga0075018_10016849 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300006354|Ga0075021_10727232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 638 | Open in IMG/M |
| 3300006572|Ga0074051_11390332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300006640|Ga0075527_10050660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 1120 | Open in IMG/M |
| 3300006852|Ga0075433_10928832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 759 | Open in IMG/M |
| 3300006864|Ga0066797_1040463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1642 | Open in IMG/M |
| 3300007255|Ga0099791_10009958 | All Organisms → cellular organisms → Bacteria | 3961 | Open in IMG/M |
| 3300007258|Ga0099793_10471922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 622 | Open in IMG/M |
| 3300009030|Ga0114950_11140068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 608 | Open in IMG/M |
| 3300009143|Ga0099792_10103060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 1502 | Open in IMG/M |
| 3300009524|Ga0116225_1299493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 718 | Open in IMG/M |
| 3300009528|Ga0114920_10919482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300009529|Ga0114919_10593697 | Not Available | 759 | Open in IMG/M |
| 3300010159|Ga0099796_10020191 | Not Available | 2032 | Open in IMG/M |
| 3300010234|Ga0136261_1086631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 674 | Open in IMG/M |
| 3300010379|Ga0136449_100590813 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300010379|Ga0136449_104473353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300010859|Ga0126352_1077943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300011080|Ga0138568_1025450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300011107|Ga0151490_1054675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 515 | Open in IMG/M |
| 3300011118|Ga0114922_10051687 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
| 3300011270|Ga0137391_10655914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 875 | Open in IMG/M |
| 3300012096|Ga0137389_11130353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 671 | Open in IMG/M |
| 3300012156|Ga0153920_1075171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 623 | Open in IMG/M |
| 3300012202|Ga0137363_11709634 | Not Available | 522 | Open in IMG/M |
| 3300012205|Ga0137362_10248399 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300012354|Ga0137366_10258901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1288 | Open in IMG/M |
| 3300012356|Ga0137371_10567878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 873 | Open in IMG/M |
| 3300012361|Ga0137360_11023315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 713 | Open in IMG/M |
| 3300012404|Ga0134024_1233008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 628 | Open in IMG/M |
| 3300012406|Ga0134053_1271601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300012925|Ga0137419_10854744 | Not Available | 747 | Open in IMG/M |
| 3300012989|Ga0164305_11142986 | Not Available | 671 | Open in IMG/M |
| 3300013080|Ga0153913_1285506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 588 | Open in IMG/M |
| 3300014152|Ga0181533_1343411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300014493|Ga0182016_10013291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7803 | Open in IMG/M |
| 3300014501|Ga0182024_11671111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 719 | Open in IMG/M |
| 3300016294|Ga0182041_11878727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 556 | Open in IMG/M |
| 3300017925|Ga0187856_1114522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1053 | Open in IMG/M |
| 3300019263|Ga0184647_1117913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 618 | Open in IMG/M |
| 3300019284|Ga0187797_1717519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1544 | Open in IMG/M |
| 3300021082|Ga0210380_10408723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 621 | Open in IMG/M |
| 3300022220|Ga0224513_10437906 | Not Available | 530 | Open in IMG/M |
| 3300022413|Ga0224508_10642118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300023101|Ga0224557_1005423 | All Organisms → cellular organisms → Bacteria | 8932 | Open in IMG/M |
| 3300024433|Ga0209986_10055482 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300025906|Ga0207699_10275590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1167 | Open in IMG/M |
| 3300026088|Ga0207641_12067153 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026352|Ga0210107_1069673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 565 | Open in IMG/M |
| 3300026514|Ga0257168_1114594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 600 | Open in IMG/M |
| 3300026551|Ga0209648_10103566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2327 | Open in IMG/M |
| 3300026817|Ga0207775_117663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 537 | Open in IMG/M |
| 3300027043|Ga0207800_1055598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 524 | Open in IMG/M |
| 3300027502|Ga0209622_1059184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300027758|Ga0209379_10263595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 583 | Open in IMG/M |
| 3300027846|Ga0209180_10572490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 627 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10567087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 555 | Open in IMG/M |
| (restricted) 3300027997|Ga0255057_10100798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1396 | Open in IMG/M |
| 3300031226|Ga0307497_10110770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
| 3300031505|Ga0308150_1036369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 567 | Open in IMG/M |
| 3300031544|Ga0318534_10534619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300031546|Ga0318538_10424774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300031668|Ga0318542_10659672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300031719|Ga0306917_11129950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300031777|Ga0318543_10514765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
| 3300031894|Ga0318522_10349028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 560 | Open in IMG/M |
| 3300031912|Ga0306921_11498081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300031942|Ga0310916_11122497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300031946|Ga0310910_11455659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300031962|Ga0307479_10938287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 836 | Open in IMG/M |
| 3300032076|Ga0306924_11984095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300032132|Ga0315336_1260312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 603 | Open in IMG/M |
| 3300032160|Ga0311301_11342627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300032173|Ga0315268_11929308 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300032272|Ga0316189_10833609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300034065|Ga0334827_210190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300034643|Ga0370545_084457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum | 669 | Open in IMG/M |
| 3300034659|Ga0314780_137011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300034661|Ga0314782_135605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.83% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.94% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.94% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.94% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.97% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.97% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 0.97% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.97% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.97% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.97% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.97% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.97% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2189573005 | Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen) | Environmental | Open in IMG/M |
| 3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001143 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001204 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001394 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300003704 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003710 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004593 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004964 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005786 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010234 | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012156 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ004 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013080 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026352 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
| 3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_01572810 | 2067725001 | Soil | MPVERRERAIAIGSGSTGNGRNPDVQWKAAGFVRWHEPDDARVSSPDL |
| L01_08210190 | 2170459006 | Grass Soil | GSGVMPAERRERAIAVELGSIGHTGRNPNVQRKAAAFARWHEPDDARVSSPDL |
| FG3_10108510 | 2189573005 | Grass Soil | MPVERRGWVIALEIGSTGNGRNPDIQWKAAAFVRWHEPDDARVSSPD |
| JGI12638J13249_1027573 | 3300001141 | Forest Soil | MPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSP |
| JGI12687J13287_1012733 | 3300001143 | Forest Soil | MPVERRGQAIAIWLGSTGAGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPDL*EARGEIPRAYSA |
| JGI12652J13314_1009041 | 3300001204 | Forest Soil | MPVERRGQAIAIWLGSTGAGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPDL*EAXGEIPRAYSA |
| JGI20191J14862_10246761 | 3300001394 | Arctic Peat Soil | SGVMPVERRGRVIAVESGQLGQTGRSPTFQRKTAALVRWHEPDDARVSSPDL* |
| JGI12627J18819_103010192 | 3300001867 | Forest Soil | VERRERVIAICIGSTGNGRNPVYKWKAAAFVRWHEPDDARVSSP |
| JGI12627J18819_103108433 | 3300001867 | Forest Soil | MPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPD |
| C688J35102_1192931471 | 3300002568 | Soil | MPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRRHEPDDARVSSPDL* |
| JGI25615J43890_10468472 | 3300002910 | Grasslands Soil | MPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSPDL* |
| Ga0008088_1023402 | 3300003704 | Tropical Rainforest Soil | MPMERRGWVIVVERGPTGSTGRSPQFQRKAAAFVRWHEPDDARVSRPESVRGS |
| Ga0008089_1011522 | 3300003710 | Tropical Rainforest Soil | MPMERRGWVIVVERGPTGSTGRSPQFQRKAAAFVRWHEPDDA |
| Ga0068965_13183791 | 3300004471 | Peatlands Soil | MPVERRGRVIAVELGPTGLYPGRSPKFRRKAAAFVRWHEPDDARVSSP |
| Ga0068946_10000803 | 3300004593 | Peatlands Soil | MPVERRGRVIAVERGPTGLYPGRSPKFRQKAAAFVRWHEPDDARVS |
| Ga0068926_14073273 | 3300004615 | Peatlands Soil | MPVERRGRVIAVELGPTGLYPGRSPKFRRKAAAFVRWHEPDDAR |
| Ga0072331_11646193 | 3300004964 | Peatlands Soil | MPVEQRGQVIAVELGPTGHAGRSPKVQREAAAFVRWHEPDDARVSSP |
| Ga0066676_100490481 | 3300005186 | Soil | MPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVS |
| Ga0066388_1013458171 | 3300005332 | Tropical Forest Soil | GQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL* |
| Ga0070709_103445771 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVERSEQVIAVEIGSTGNGRSPIFKWKAAAFKRWHEPDDARVSSPESVRDSG* |
| Ga0070707_1010952232 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVERRGQAIAIWLGSTGVGSNRHQEEPDVQWKAAAFARWHEPDDARVSSPDL* |
| Ga0078433_1125641 | 3300005786 | Sediment | EGSVMGLERRVQVIAVELGPTGHAGRSPMVQRKAAAFV* |
| Ga0066795_102165452 | 3300005938 | Soil | MPVERRGRVIAVELGQLGQTGRSPTFQRKAAALVRWHEPDDARVSSP |
| Ga0075018_100168491 | 3300006172 | Watersheds | VMPVERRGWVIAFEIGSTGNEEPDIQWKAAAFVRWHEPDDARVSSPDL* |
| Ga0075021_107272323 | 3300006354 | Watersheds | RSGVMPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL* |
| Ga0074051_113903321 | 3300006572 | Soil | VERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPD |
| Ga0075527_100506601 | 3300006640 | Arctic Peat Soil | RGRVIAVESGQLGQTGRSPTFQRKAAALVRWHEPDDARVSSPDL* |
| Ga0075433_109288321 | 3300006852 | Populus Rhizosphere | VMPVERREQAIAIWIGVNRQREDPDIQWKAAAFVRWHEPDDARVSRPDL* |
| Ga0066797_10404633 | 3300006864 | Soil | MGWVIAVELGQLGQTGRSPTFQRKAAALVRWHEPDDARVSSPDL* |
| Ga0099791_100099585 | 3300007255 | Vadose Zone Soil | MPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWREPDDARVSRPDL* |
| Ga0099793_104719221 | 3300007258 | Vadose Zone Soil | MPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSSPESVR |
| Ga0114950_111400681 | 3300009030 | Deep Subsurface | SDEASVMLVERRGRVIVVERGPTGYAGRSPMVQRKAAAFVRWHEPDDARVSCPDL* |
| Ga0099792_101030601 | 3300009143 | Vadose Zone Soil | MPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL* |
| Ga0116225_12994931 | 3300009524 | Peatlands Soil | MLAERRGQVIAVELGPTGYAGRSPKVQRKAAAFERWHEPDDARVSSP |
| Ga0114920_109194821 | 3300009528 | Deep Subsurface | MELERRGQVIVIGLGPTGYAGRSPLVQWKAAAFVRWHEPYDARVS |
| Ga0114919_105936971 | 3300009529 | Deep Subsurface | MGLERRGRVIVAGLGPTGHAGRSPLVQWKAAAFVR |
| Ga0099796_100201913 | 3300010159 | Vadose Zone Soil | MLVERRGRVIAVELGPTGGTGRSPKVQRKAAAFARWHEPDDA |
| Ga0136261_10866312 | 3300010234 | Freshwater | MELERRGRVIAVGLGPTGYAGRSPLVQRKAVAFVRWHEPDDARA |
| Ga0136449_1005908132 | 3300010379 | Peatlands Soil | VMPVEQRGRVIAVELGPTGSNQEELEIQRKAAAFVR* |
| Ga0136449_1044733532 | 3300010379 | Peatlands Soil | MPVEQRGRVIAVELGPTGSNQEEPELQRKAAAFVR* |
| Ga0126352_10779431 | 3300010859 | Boreal Forest Soil | MPVERREQVIAVSSGQPDHTGRSPNVQGKAAAFMRWHEPDDARVS |
| Ga0138568_10254502 | 3300011080 | Peatlands Soil | VERRGQVIAVELGPTGLYPGRSPNVQRKAAAFVRWHEP |
| Ga0151490_10546751 | 3300011107 | Soil | GVMLVERRGRVIAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL* |
| Ga0114922_100516873 | 3300011118 | Deep Subsurface | MELERRGQVIVVGLGPTGHAGRSPPAQRKAAAFVRW |
| Ga0137391_106559141 | 3300011270 | Vadose Zone Soil | RGRVIAVELGPTGGAGRSPKVQRKAAAFARWHEPDDARVSSPDL* |
| Ga0137389_111303532 | 3300012096 | Vadose Zone Soil | GQVIAVEHGPTGLNREEPEVQRKAAAFALWHEPDDARVSRPDL* |
| Ga0153920_10751711 | 3300012156 | Attine Ant Fungus Gardens | VERRERVIAIYIGSTGNGRNPVYKWKAAAFVRWHEPDDARVSSPDL* |
| Ga0137363_117096341 | 3300012202 | Vadose Zone Soil | MPVERRGWVIAVELGPTGGARRSPKVQRKAAAFARW |
| Ga0137362_102483991 | 3300012205 | Vadose Zone Soil | MPVERRGWVIAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL |
| Ga0137366_102589011 | 3300012354 | Vadose Zone Soil | GVMLVERRGRVIAVELGPTGGAGRSPKVQRKAAAFAR* |
| Ga0137371_105678782 | 3300012356 | Vadose Zone Soil | ERVTAIWLGSTGNGREPDVQWRAAAFTRWHEPDDARVSSPDL* |
| Ga0137360_110233152 | 3300012361 | Vadose Zone Soil | PVERRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDERVSRPDL* |
| Ga0134024_12330081 | 3300012404 | Grasslands Soil | MLVERRGRVIAVELGPTGGAGRSPKVQRKAAAFVR |
| Ga0134053_12716011 | 3300012406 | Grasslands Soil | VERRGRVIAVELGPTGGAGRSPKVQRKAAAFARWH |
| Ga0137419_108547441 | 3300012925 | Vadose Zone Soil | MLVERRGRVIAVELGPTGGTGRSPKVQRKAAAFARWHEPD |
| Ga0164305_111429862 | 3300012989 | Soil | MLVERRGRVIAVELGPTGGAGRSPKVQRKAAAFARWHE |
| Ga0153913_12855061 | 3300013080 | Freshwater Wetlands | MGLERRGRVIAVEPEPTGACRDEPVVQRKAAAFVRWHEPYDARVSR |
| Ga0181533_13434111 | 3300014152 | Bog | MPVERRGRVIAVESGQLGQTGRSPTLQRKAAAFVRWH |
| Ga0182016_100132918 | 3300014493 | Bog | MLVERRGQVIAVEIGPTGHAGRGPTVQRKAAAFVRWHEPDDARVSSPVL* |
| Ga0182024_116711111 | 3300014501 | Permafrost | MLAERRGQVIAVELGPTGYAGRSPKVQRKAAAFERWHEPDDARVSS |
| Ga0182041_118787271 | 3300016294 | Soil | MPVERREQVIAVRAGQPDHTGRSPNVQRKAAAFMRWHEPDD |
| Ga0187856_11145222 | 3300017925 | Peatland | MLVERRGQVIAVEIGPTGYAGRSPTVQRKAAAFVRWHEPDDARVS |
| Ga0184647_11179132 | 3300019263 | Groundwater Sediment | VERREQAIAIWLGSTGYGRNPVFNGKAAAFVRWHEPDDARVSSP |
| Ga0187797_17175191 | 3300019284 | Peatland | PVERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPDDARVSSPDL |
| Ga0210380_104087231 | 3300021082 | Groundwater Sediment | VERREQAIAIWLGSTGYGRNPVFNGKAAAFVRWHEPDDARVSS |
| Ga0224513_104379061 | 3300022220 | Sediment | MGLERRGRVIVAGLGPTGHAGRSPLVQWKAAAFVRWQEPDDA |
| Ga0224508_106421181 | 3300022413 | Sediment | MLVERRGRVIAVERGPTGYAGRSPIVRQKAAAFVRWHEPDDVRVSSPDLWAAGG |
| Ga0224557_10054238 | 3300023101 | Soil | MLVERRGQVIAVEIGPTGHAGRGPTVQRKAAAFVRWHEPDDARVSSPVL |
| Ga0209986_100554821 | 3300024433 | Deep Subsurface | MGLERRGRVIVAGLGPTGHAGRSPLVQWKAAAFVRSQE |
| Ga0207699_102755902 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVERSEQVIAVEIGSTGNGRSPIFKWKAAAFKRWHEPDDARVSSPESVRDSG |
| Ga0207641_120671531 | 3300026088 | Switchgrass Rhizosphere | MLVERRGRVIAVELGPTGGARRSPKVQRKAAAFVRWHEPDDARVSS |
| Ga0210107_10696731 | 3300026352 | Natural And Restored Wetlands | MGLERRGRVIVTGLGPTGHAGRSPLVQWKAAAFVRWQEPDDARVSSPDVRPAKAGM |
| Ga0257168_11145941 | 3300026514 | Soil | VEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDEARVSRPDV |
| Ga0209648_101035661 | 3300026551 | Grasslands Soil | MPVEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDDARVSRPDL |
| Ga0207775_1176631 | 3300026817 | Tropical Forest Soil | VERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPDDARVSSP |
| Ga0207800_10555982 | 3300027043 | Tropical Forest Soil | VERREQAIAVELGSTGSTGRNPNLRRKAAAFVRWHEPDDARVSSPD |
| Ga0209622_10591841 | 3300027502 | Forest Soil | MPVERRGQAIAIWLGSTGAGSNRHQEEPDVQWKAAAFVRWHEPDDARVSSP |
| Ga0209379_102635951 | 3300027758 | Marine Sediment | MGLERRGRVIAVELGPTGHAGRSPLVQRKAAAFVR |
| Ga0209180_105724902 | 3300027846 | Vadose Zone Soil | VEQRGQVIAVEHGPTGLNREEPEVQRKAAAFARWHEPDD |
| (restricted) Ga0255058_105670871 | 3300027872 | Seawater | MELERRGQVIVIGLGPTGYAGRSPLVQWKAAAFVRWHEPYDARVSRTVLRG |
| (restricted) Ga0255057_101007981 | 3300027997 | Seawater | VLERRGQVIAVELGPTGYAGRSPLVQRKAAAFMRWHEPDDAR |
| Ga0307497_101107702 | 3300031226 | Soil | EAGVMLVERRGRVIAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL |
| Ga0308150_10363692 | 3300031505 | Soil | LERRGRVIAVELGPTGGAGRSPKVQRKAAAFARWHEPDDA |
| Ga0318534_105346191 | 3300031544 | Soil | MPVEQREQVIAASAGQPDHTGRSPNVQRKAAAFMRWHEPDDARVSRPD |
| Ga0318538_104247742 | 3300031546 | Soil | MPVEQREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHEPDDARVSRP |
| Ga0318542_106596721 | 3300031668 | Soil | VEQREQVIAASAGQPDHTGRSPNVQRKAAAFMRWHEPDDAR |
| Ga0306917_111299501 | 3300031719 | Soil | MPAERRERAIAVELGSTGHTGRNPNVQRKAAAFMRWHEPDD |
| Ga0318543_105147651 | 3300031777 | Soil | MPVEQREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHEPD |
| Ga0318522_103490281 | 3300031894 | Soil | MPVERREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHE |
| Ga0306921_114980811 | 3300031912 | Soil | EIGSTGNGRNPIFNWKAAAFARWHEPDDARVSSPDL |
| Ga0310916_111224971 | 3300031942 | Soil | VERRERAIAICWVNRQREEPDVQWKAAGFVRWHEPDDARVSSPVVCPAK |
| Ga0310910_114556591 | 3300031946 | Soil | VERREQVIAVRAGQPDHTGRSPHVQRKVAAFMRWHEP |
| Ga0307479_109382872 | 3300031962 | Hardwood Forest Soil | VERRERVIAICIGSTGNGRNPVYKWKAAAFVRWHEPDDARV |
| Ga0310911_106251401 | 3300032035 | Soil | VERREQVIAVRAGQPDHTGRSPHVQRKAAAFMRWHEPDDARVSRPVVCPGKASMF |
| Ga0306924_119840951 | 3300032076 | Soil | MPVEQREQVIAASSGQPDHTGRSPNVQRKAAAFMRWHE |
| Ga0315336_12603121 | 3300032132 | Seawater | MELERRGRVIAVERGSTGHAGRNPMVRRKAAAFVRWHEPDDARVSSP |
| Ga0311301_113426271 | 3300032160 | Peatlands Soil | MPVEQRGRVIAVELGPTGSNQEEPELQRKAAAFVR |
| Ga0315268_119293082 | 3300032173 | Sediment | IAVELGPTGGARRSPKVQRKAAAFARWHEPDDARVSSPDL |
| Ga0316189_108336091 | 3300032272 | Worm Burrow | MELERRGRVIVVELGPTGHAGRSPPAQRKAAAFVRWHEPYDARV |
| Ga0334827_210190_439_579 | 3300034065 | Soil | MLVERRGQVIAVEIGPTGHAGRGPTVQRKAAAFVRWHEPDDARVSSP |
| Ga0370545_084457_3_107 | 3300034643 | Soil | MLVERWGRVTAVEHGSTGFGQEEPEAQRKAAAFAR |
| Ga0314780_137011_1_135 | 3300034659 | Soil | MERRERAIAIWLGSTGDGRNPMFKRKAAAFVRWHEPDDARVSSPD |
| Ga0314782_135605_3_134 | 3300034661 | Soil | MERRERAIAIWLGSTGDGRNPMFKRKAAAFVRWHEPDDARVSSP |
| ⦗Top⦘ |