


| Basic Information | |
|---|---|
| Family ID | F099806 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 50 residues |
| Representative Sequence | TVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 99.03 % |
| % of genes from short scaffolds (< 2000 bps) | 94.17 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.592 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.951 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.92% β-sheet: 19.23% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 2.91 |
| PF04355 | SmpA_OmlA | 2.91 |
| PF03992 | ABM | 2.91 |
| PF01475 | FUR | 1.94 |
| PF07690 | MFS_1 | 0.97 |
| PF11842 | DUF3362 | 0.97 |
| PF13458 | Peripla_BP_6 | 0.97 |
| PF01343 | Peptidase_S49 | 0.97 |
| PF01435 | Peptidase_M48 | 0.97 |
| PF04191 | PEMT | 0.97 |
| PF00583 | Acetyltransf_1 | 0.97 |
| PF13205 | Big_5 | 0.97 |
| PF05598 | DUF772 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 2.91 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.91 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 1.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2007427000|2007485014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300002568|C688J35102_118674505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300004047|Ga0055499_10000076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4117 | Open in IMG/M |
| 3300004081|Ga0063454_100165969 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300004114|Ga0062593_100021163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3442 | Open in IMG/M |
| 3300004463|Ga0063356_101562754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 980 | Open in IMG/M |
| 3300004643|Ga0062591_101116521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300005213|Ga0068998_10006343 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300005295|Ga0065707_11106262 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 514 | Open in IMG/M |
| 3300005329|Ga0070683_102350839 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 511 | Open in IMG/M |
| 3300005332|Ga0066388_102376578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300005343|Ga0070687_100392144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300005355|Ga0070671_100797991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300005406|Ga0070703_10307028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300005439|Ga0070711_100448061 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300005444|Ga0070694_101368722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300005457|Ga0070662_101446041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300005536|Ga0070697_101913022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300005539|Ga0068853_102470630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300005546|Ga0070696_100296121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1238 | Open in IMG/M |
| 3300005614|Ga0068856_100299291 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300005841|Ga0068863_102028679 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006049|Ga0075417_10710538 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006172|Ga0075018_10382008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300006578|Ga0074059_10551431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300006581|Ga0074048_13439320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300006604|Ga0074060_10749461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300006880|Ga0075429_100370732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1253 | Open in IMG/M |
| 3300006954|Ga0079219_11220335 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300007255|Ga0099791_10128125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1178 | Open in IMG/M |
| 3300009137|Ga0066709_103472721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300009162|Ga0075423_10058035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4000 | Open in IMG/M |
| 3300010337|Ga0134062_10195812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300010358|Ga0126370_10124015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1837 | Open in IMG/M |
| 3300010358|Ga0126370_11916559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010362|Ga0126377_12748661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300010362|Ga0126377_13110569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300010366|Ga0126379_12242014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300010403|Ga0134123_10870265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300011119|Ga0105246_10423731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1111 | Open in IMG/M |
| 3300011433|Ga0137443_1270036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300011444|Ga0137463_1020110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2387 | Open in IMG/M |
| 3300012166|Ga0137350_1035929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 946 | Open in IMG/M |
| 3300012179|Ga0137334_1063774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300012469|Ga0150984_108951203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300012498|Ga0157345_1049340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300012922|Ga0137394_11134637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300012930|Ga0137407_10977407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300012957|Ga0164303_10580891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300012958|Ga0164299_10401059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300012960|Ga0164301_11190451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300012971|Ga0126369_10690259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1097 | Open in IMG/M |
| 3300012984|Ga0164309_11813930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300012989|Ga0164305_10666988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300014302|Ga0075310_1057307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300014326|Ga0157380_12584178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300014968|Ga0157379_10892992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300015245|Ga0137409_10848443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300015371|Ga0132258_10468440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3144 | Open in IMG/M |
| 3300019362|Ga0173479_10443368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300019997|Ga0193711_1034466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300021081|Ga0210379_10343235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300024232|Ga0247664_1072574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300024251|Ga0247679_1021957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300025711|Ga0207696_1055435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1124 | Open in IMG/M |
| 3300025908|Ga0207643_10740945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300025923|Ga0207681_10026315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3751 | Open in IMG/M |
| 3300025936|Ga0207670_10537606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300025940|Ga0207691_11152752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300025954|Ga0210135_1004863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1135 | Open in IMG/M |
| 3300025957|Ga0210089_1002664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1638 | Open in IMG/M |
| 3300025961|Ga0207712_12116744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300025979|Ga0210078_1036744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300025981|Ga0207640_11279221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300026035|Ga0207703_12331624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300026325|Ga0209152_10399742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300026820|Ga0207603_101700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300027633|Ga0208988_1164357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300027731|Ga0209592_1338326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300027873|Ga0209814_10389430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300027886|Ga0209486_11010555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300028065|Ga0247685_1007644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1334 | Open in IMG/M |
| 3300028146|Ga0247682_1086094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300028802|Ga0307503_10255458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300028802|Ga0307503_10473390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300028809|Ga0247824_10206902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1075 | Open in IMG/M |
| 3300031184|Ga0307499_10314250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300031199|Ga0307495_10028744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1005 | Open in IMG/M |
| 3300031199|Ga0307495_10172391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300031226|Ga0307497_10077330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1242 | Open in IMG/M |
| 3300031548|Ga0307408_102079738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031716|Ga0310813_10872110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300031720|Ga0307469_10269437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1383 | Open in IMG/M |
| 3300031720|Ga0307469_12294456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300031740|Ga0307468_102062368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031858|Ga0310892_10210050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1177 | Open in IMG/M |
| 3300031903|Ga0307407_10734450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300032012|Ga0310902_10076303 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300032180|Ga0307471_102673072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300033004|Ga0335084_11067360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300033432|Ga0326729_1022216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300033550|Ga0247829_10233876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1473 | Open in IMG/M |
| 3300034659|Ga0314780_181162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2007427000 | Uranium contaminated groundwater from Oak Ridge Integrated Field Research Center, Tennessee | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025954 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026820 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2007503462 | 2007427000 | Groundwater | DGPSWTLSETRLFDANNGALVWTGVVDTRENDNLGAALTGYVGMIFDAMVRDRVL |
| C688J35102_1186745051 | 3300002568 | Soil | TRLFDARNGALAWTGIVETKENDDIGAALTQYINLVFDAMVKDRVL* |
| Ga0055499_100000767 | 3300004047 | Natural And Restored Wetlands | TWTLSETRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL* |
| Ga0063454_1001659691 | 3300004081 | Soil | RLFDAKNGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL* |
| Ga0062593_1000211638 | 3300004114 | Soil | SETRLFDARNGALAWTGVVDTRENDNLGEALTEYVDMIFDAMVSDRVL* |
| Ga0063356_1015627541 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TGPSWTVSETRLFDAKSGVLAWTGVVDTREHDDLGAALTQYMKVIFDAMVDDRVL* |
| Ga0062591_1011165212 | 3300004643 | Soil | RLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL* |
| Ga0068998_100063434 | 3300005213 | Natural And Restored Wetlands | TRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL* |
| Ga0065707_111062622 | 3300005295 | Switchgrass Rhizosphere | EQTITGQTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL* |
| Ga0070683_1023508392 | 3300005329 | Corn Rhizosphere | FDAKTGALAWTGLVDTKQNDKLDAAMTQYINVIFDAMVGDKVL* |
| Ga0066388_1023765781 | 3300005332 | Tropical Forest Soil | DAKNGALAWTGVMDTREYDDLGAALTQYIDVVFDAMVRDRVL* |
| Ga0070687_1003921442 | 3300005343 | Switchgrass Rhizosphere | TAPQQINGPSWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL* |
| Ga0070671_1007979912 | 3300005355 | Switchgrass Rhizosphere | TGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL* |
| Ga0070703_103070282 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | WTVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL* |
| Ga0070711_1004480613 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TGPKYTLTETRLFDAKDGTLAWTGVVNTRESDDLNAALTQYIDIIFDAMVSDRVL* |
| Ga0070694_1013687222 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYIDMVFDAMVGDRVL* |
| Ga0070662_1014460411 | 3300005457 | Corn Rhizosphere | TGPTWTVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL* |
| Ga0070697_1019130222 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LFDAKNGALAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL* |
| Ga0068853_1024706302 | 3300005539 | Corn Rhizosphere | TVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL* |
| Ga0070696_1002961211 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AQKISGPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYIDMVFDAMVGDRVL* |
| Ga0068856_1002992911 | 3300005614 | Corn Rhizosphere | TGPTWTLTETRLFDAKNGELAWTGVVNTRQDDDFNAALTQYIDVIFDAMVNDRVL* |
| Ga0068863_1020286791 | 3300005841 | Switchgrass Rhizosphere | TWTLAETRLFDAKSGVLAWTGVVDTRKTDDVGGALTEFIDVIFDAMVSGHVL* |
| Ga0075417_107105382 | 3300006049 | Populus Rhizosphere | SETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL* |
| Ga0075018_103820081 | 3300006172 | Watersheds | TLAWTGVMDTRENDDLGAALTQYLDVIFDAMVRDRVL* |
| Ga0074059_105514311 | 3300006578 | Soil | GALAWTGVMDTRENDDLGAALTQYIEVIFDAMVNDRVL* |
| Ga0074048_134393202 | 3300006581 | Soil | QTVTGQTWTVSETRLFDAKSGALAWTGLVDTRQNDKLDAAMTQYINVIFDAMVGDKVL* |
| Ga0074060_107494612 | 3300006604 | Soil | SETRLFDAKSGALAWTGIMDTRENDDISAVLTQYIDVIFDAMVGDRVL* |
| Ga0075429_1003707321 | 3300006880 | Populus Rhizosphere | TATVPARQETIASWTLSETRLFDASNGALAWTGIVDTRENDDLGATLAQYLEVIFGAMVDDRVL* |
| Ga0079219_112203351 | 3300006954 | Agricultural Soil | TAPQQISGPSWTLSETRLFDARNGALAWTGIVDTKENDDLGAALTEYVNIIFDAMVRDRVL* |
| Ga0099791_101281253 | 3300007255 | Vadose Zone Soil | SETRLFDAKNGALAWTGLMDTKQNDKLDASMTQYINVIFDAMVGDKVL* |
| Ga0066709_1034727211 | 3300009137 | Grasslands Soil | GPLWTLSETRLFDAKSGMLAWTGMVDTRENERLDEALTQYINLIFDAMVSDRVL* |
| Ga0075423_100580356 | 3300009162 | Populus Rhizosphere | WTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL* |
| Ga0134062_101958123 | 3300010337 | Grasslands Soil | PQKITGPTWTLSETRLFDAKSGVLAWSGVVDTRKSDNAGEALTDYVNIIFEAMVGDRVL* |
| Ga0126370_101240153 | 3300010358 | Tropical Forest Soil | AKNGVLAWTGVMDTRENDDLGAALTQYINVVFEAMVRDRVL* |
| Ga0126370_119165592 | 3300010358 | Tropical Forest Soil | VNLPPQQVTGPSWTVSETRLFDAKNGALAWMGVVDTREYDDLGAALTQYIDVVFDAMVRDRVL* |
| Ga0126377_127486612 | 3300010362 | Tropical Forest Soil | PQQVNGPSWTVSETRLFDAKNGVLAWTGVMETRENDDLNAALTQYIEVVFDAMVRDRVL* |
| Ga0126377_131105692 | 3300010362 | Tropical Forest Soil | FDARNGALAWTGIVDTREANDFNAALTQYIQVIFDAMVGDRVI* |
| Ga0126379_122420141 | 3300010366 | Tropical Forest Soil | WTGVMETRENDDLNAALTQYIEVVFDAMVRDRVL* |
| Ga0134123_108702651 | 3300010403 | Terrestrial Soil | KSGVLAWTGVVDTRKTDDVGAALTEFVHVIFDAMVSGRVL* |
| Ga0105246_104237311 | 3300011119 | Miscanthus Rhizosphere | NGALAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL* |
| Ga0137443_12700361 | 3300011433 | Soil | IGPQWTVSETRLFDARNGALAWTGIVDTKETENFNAALTQYIQVIFDAMVGDRVI* |
| Ga0137463_10201101 | 3300011444 | Soil | PSWTVSETRLFDAKSGVLAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL* |
| Ga0137350_10359291 | 3300012166 | Soil | QWTVSETRLFDARNGALAWTGIVDTKETENFNAALTQYIQVIFDAMVGDRVI* |
| Ga0137334_10637742 | 3300012179 | Soil | PSWTVSETRLFDAKSGVLAWTGVVDTREHDELGAALTQYMKVIFDAMVDDRVL* |
| Ga0150984_1089512032 | 3300012469 | Avena Fatua Rhizosphere | LFDAKSGMLAWTGMVDTRENERLDEALTQYINLIFDAMVKDRVL* |
| Ga0157345_10493402 | 3300012498 | Arabidopsis Rhizosphere | WTVSETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL* |
| Ga0137394_111346372 | 3300012922 | Vadose Zone Soil | TGPSWTVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL* |
| Ga0137407_109774072 | 3300012930 | Vadose Zone Soil | AWTGVMDTRENDNLGAALTQYIDVIFDAMVSDRVL* |
| Ga0164303_105808911 | 3300012957 | Soil | LAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL* |
| Ga0164299_104010592 | 3300012958 | Soil | SETRLFDAKNGVLAWTGLVDTPENDDLDAVLTQYVNLIFDAMVNDRIL* |
| Ga0164301_111904512 | 3300012960 | Soil | TGTLAWTGIVDTKENDNLGAALTQYVNIIFDAMVRDRVL* |
| Ga0126369_106902591 | 3300012971 | Tropical Forest Soil | KNGVLAWTGVMDTREYDDLGAALTQYIDVVFDAMVRDRVL* |
| Ga0164309_118139302 | 3300012984 | Soil | APEKITGPSWTVSETRLFDTRNGALAWTGVMDTRENDDLGAALTQYIEVIFDAMVSDRVL |
| Ga0164305_106669882 | 3300012989 | Soil | AKNGVLAWTGLVDTPENDDLDAVLTQYVNLIFDAMVNDRIL* |
| Ga0075310_10573071 | 3300014302 | Natural And Restored Wetlands | RLFDAKTGTLAWTGIVETRPGDGLDAALTQYIDVIFDAMVSDRVL* |
| Ga0157380_125841782 | 3300014326 | Switchgrass Rhizosphere | SETRLFDAKNGALAWTGLVDTRNNNDIGAALTQYVGIIFDAMVSDRVL* |
| Ga0157379_108929921 | 3300014968 | Switchgrass Rhizosphere | TGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL* |
| Ga0137409_108484432 | 3300015245 | Vadose Zone Soil | SWTVSETRLFDARNGVLAWTGIVDTRENHDFAAVLTQYIEVIFDAMVGDRVL* |
| Ga0132258_104684404 | 3300015371 | Arabidopsis Rhizosphere | QINGPSWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL* |
| Ga0173479_104433682 | 3300019362 | Soil | WQTVNTPAQKISGPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYIDMVFDAMVGDRVL |
| Ga0193711_10344661 | 3300019997 | Soil | SAQKVTGPSWTVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL |
| Ga0210379_103432351 | 3300021081 | Groundwater Sediment | LAWTGIVDTKETENFNAALTQYIQVIFDAMVGDRVI |
| Ga0247664_10725742 | 3300024232 | Soil | RLFDAKNGELAWTGVVNTRQDDDFNAALTQYIDVIFDAMVNDRVL |
| Ga0247679_10219573 | 3300024251 | Soil | PAQQISGPTWTLTETRLFDAKNGDLAWTGVVNTRQDDDFNAALTQYIDVIFDAMVNDRVL |
| Ga0207696_10554353 | 3300025711 | Switchgrass Rhizosphere | WTVSETRLFDAKNGALAWTGLVDTKQNDKLDAAMTQYIDVIFDAMVGDKVL |
| Ga0207643_107409452 | 3300025908 | Miscanthus Rhizosphere | TPAQTVTGPTWTVSETRLFDARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRV |
| Ga0207681_100263156 | 3300025923 | Switchgrass Rhizosphere | LAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL |
| Ga0207670_105376062 | 3300025936 | Switchgrass Rhizosphere | PTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVIFDAMVGDKVL |
| Ga0207691_111527522 | 3300025940 | Miscanthus Rhizosphere | SAQTVTGPSWTLSETRLFDAKSGVPAWTGIVDSPESNDLDGALTQYINIIFDAMVQDRVL |
| Ga0210135_10048631 | 3300025954 | Natural And Restored Wetlands | PTWTLSETRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL |
| Ga0210089_10026641 | 3300025957 | Natural And Restored Wetlands | TTPEQKISGPTWTLSETRLFDAKSGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL |
| Ga0207712_121167442 | 3300025961 | Switchgrass Rhizosphere | SETRLFDAKSGVLAWTGVVDTQEHDDLGAALTQYMKVIFDAMVKDRVL |
| Ga0210078_10367442 | 3300025979 | Natural And Restored Wetlands | SGALAWTGIVDTKENDDLGAALTQYINMIFDAMVSDRVL |
| Ga0207640_112792211 | 3300025981 | Corn Rhizosphere | SWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL |
| Ga0207703_123316241 | 3300026035 | Switchgrass Rhizosphere | FDAKTGSLAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL |
| Ga0209152_103997422 | 3300026325 | Soil | PLWTLSETRLFDAKSGMLAWTGMVDTRENERLDEALTQYINLIFDAMVSDRVL |
| Ga0207603_1017002 | 3300026820 | Soil | KTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVADKVL |
| Ga0208988_11643571 | 3300027633 | Forest Soil | PSWTVSETRLFDAKNGVLAWTGVMDTRENDDLSAALTQYIDVIFDAMVSDRVL |
| Ga0209592_13383261 | 3300027731 | Freshwater Sediment | KTGMLAWTGIVETRKSDGLDAALTQYIDVIFDAMVSDRVL |
| Ga0209814_103894301 | 3300027873 | Populus Rhizosphere | VSETRLFDAKTGALAWTGLVDTKQNDKLDASMTQYINVVFDAMVGDKVL |
| Ga0209486_110105552 | 3300027886 | Agricultural Soil | RLFDAKNGALAWTGLVDTRNNDDIGAALTEYVNIIFDAMVTDRVL |
| Ga0247685_10076443 | 3300028065 | Soil | WETVSVPPQTITGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL |
| Ga0247682_10860941 | 3300028146 | Soil | PQTITGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVVFDAMVGDKVL |
| Ga0307503_102554582 | 3300028802 | Soil | TVTETRLFDAKNGALAWTGVMESRETDKLDAALTQYIEVIFDAMVGDRVL |
| Ga0307503_104733902 | 3300028802 | Soil | KWTASETRLFDASNGALAWTGVVDTRESDDFAAALSQYINVIFDAMVNDRVL |
| Ga0247824_102069023 | 3300028809 | Soil | ARNGALAWTGVMDTRENDDLGAALTQYLKVIFGAMVDDRVL |
| Ga0307499_103142502 | 3300031184 | Soil | IGPKWTASETRLFDARSGALAWTGVVDTRESDSFASALTEYINVIFDAMVNDRVL |
| Ga0307495_100287442 | 3300031199 | Soil | TVSIPAQTVTGPTWTVSETRLFDAKTGALAWTGLVDTKQNDKLDAAMTQYINVIFDAMVGDKVL |
| Ga0307495_101723911 | 3300031199 | Soil | RSGALAWTGVVDTRESDSFAAALTQYIDVIFDAMVNDRVL |
| Ga0307497_100773301 | 3300031226 | Soil | TVSLSSQTITGPSMTVSETRLFDAKSGALAWTGMVDTKENDDFGAALTQYINVIFDAMVSDRVL |
| Ga0307408_1020797382 | 3300031548 | Rhizosphere | PAWTVSETRLFDAKSGALAWTGVMDTRQHDDLGAALTQYMKVIFDAMVDDRVL |
| Ga0310813_108721101 | 3300031716 | Soil | GPSWTLSETRLFDAKSGVLAWTGVVDTKENDDLGAALTQYINMVFDAMVGDRVL |
| Ga0307469_102694373 | 3300031720 | Hardwood Forest Soil | TVSETRLFDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL |
| Ga0307469_122944561 | 3300031720 | Hardwood Forest Soil | ARTGALAWTGIVDTKENDDLGAALTEYVNIIFDAMVRDRVL |
| Ga0307468_1020623681 | 3300031740 | Hardwood Forest Soil | WTMSETRLFDAKNGVLAWTGIVDTKENDDLGAALKQYIDTVFDAMVSDRVL |
| Ga0310892_102100501 | 3300031858 | Soil | NGPSWTVSETRLFDARNGALAWTGVIDTRENENLGAALTEYVNIIFDAMVRDRVL |
| Ga0307407_107344501 | 3300031903 | Rhizosphere | QQFSGPSWTVSETRLFDAKSGTLAWTGIVDTRENERLDAALTQYIGVIFDAMVGDRML |
| Ga0310902_100763033 | 3300032012 | Soil | GPQWTVSETRLFDARNGALAWTGIVDTREANDFNAALTQYIQVIFDAMVGDRVI |
| Ga0307471_1026730721 | 3300032180 | Hardwood Forest Soil | FDAKNGALAWTGVMDTRENDDLGAALTQYINVIFDAMVSDRVL |
| Ga0335084_110673602 | 3300033004 | Soil | LFDAKNGVLAWTGVMDTRETDDLSTALTQYVNVIFDAMVSDRVL |
| Ga0326729_10222161 | 3300033432 | Peat Soil | TVSETRLFDAKNGVLAWTGVMDTRENDDLSAALTQYVNVIFDAMVNDRVL |
| Ga0247829_102338761 | 3300033550 | Soil | TVSETRLFDARNGALAWTGIVDTREANDFNAALTQYIQVIFDAMVGDRVI |
| Ga0314780_181162_407_538 | 3300034659 | Soil | FDAKTGALAWTGLVDTKQNEKLDASMTQYINVIFDAMVGDKVL |
| ⦗Top⦘ |