


| Basic Information | |
|---|---|
| Family ID | F099741 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | NQTLERTADRREDLLSMTSTLKPEAQLALVSGRSACSR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.69 % |
| % of genes near scaffold ends (potentially truncated) | 81.55 % |
| % of genes from short scaffolds (< 2000 bps) | 81.55 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.932 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.330 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.835 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 2.91 |
| PF00155 | Aminotran_1_2 | 1.94 |
| PF00903 | Glyoxalase | 1.94 |
| PF03544 | TonB_C | 1.94 |
| PF12710 | HAD | 1.94 |
| PF13924 | Lipocalin_5 | 1.94 |
| PF13495 | Phage_int_SAM_4 | 1.94 |
| PF07617 | DUF1579 | 0.97 |
| PF04055 | Radical_SAM | 0.97 |
| PF11143 | DUF2919 | 0.97 |
| PF01546 | Peptidase_M20 | 0.97 |
| PF14237 | GYF_2 | 0.97 |
| PF01243 | Putative_PNPOx | 0.97 |
| PF13620 | CarboxypepD_reg | 0.97 |
| PF11528 | DUF3224 | 0.97 |
| PF02371 | Transposase_20 | 0.97 |
| PF12146 | Hydrolase_4 | 0.97 |
| PF13673 | Acetyltransf_10 | 0.97 |
| PF02517 | Rce1-like | 0.97 |
| PF08592 | Anthrone_oxy | 0.97 |
| PF13964 | Kelch_6 | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF14026 | DUF4242 | 0.97 |
| PF13827 | DUF4189 | 0.97 |
| PF08774 | VRR_NUC | 0.97 |
| PF13419 | HAD_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.94 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.93 % |
| Unclassified | root | N/A | 31.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16706296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1815 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104977057 | Not Available | 512 | Open in IMG/M |
| 3300000652|ARCol0yngRDRAFT_1011726 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300000956|JGI10216J12902_103611783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
| 3300000956|JGI10216J12902_103771791 | Not Available | 1240 | Open in IMG/M |
| 3300000956|JGI10216J12902_106715218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1436 | Open in IMG/M |
| 3300003911|JGI25405J52794_10083546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 704 | Open in IMG/M |
| 3300005093|Ga0062594_102232582 | Not Available | 593 | Open in IMG/M |
| 3300005166|Ga0066674_10445083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 593 | Open in IMG/M |
| 3300005175|Ga0066673_10049659 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300005178|Ga0066688_10515301 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 769 | Open in IMG/M |
| 3300005179|Ga0066684_10352064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 985 | Open in IMG/M |
| 3300005180|Ga0066685_10916866 | Not Available | 584 | Open in IMG/M |
| 3300005187|Ga0066675_11427552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 506 | Open in IMG/M |
| 3300005457|Ga0070662_101424772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 597 | Open in IMG/M |
| 3300005518|Ga0070699_100154745 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2029 | Open in IMG/M |
| 3300005529|Ga0070741_10099949 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
| 3300005536|Ga0070697_100626443 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300005545|Ga0070695_100197081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1437 | Open in IMG/M |
| 3300005556|Ga0066707_10043900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2557 | Open in IMG/M |
| 3300005557|Ga0066704_10203534 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1339 | Open in IMG/M |
| 3300005559|Ga0066700_10782778 | Not Available | 644 | Open in IMG/M |
| 3300005561|Ga0066699_10869978 | Not Available | 630 | Open in IMG/M |
| 3300005575|Ga0066702_10222628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1148 | Open in IMG/M |
| 3300005764|Ga0066903_101044300 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300005937|Ga0081455_10107907 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2219 | Open in IMG/M |
| 3300005937|Ga0081455_10501653 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 815 | Open in IMG/M |
| 3300005985|Ga0081539_10117039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300005985|Ga0081539_10213014 | Not Available | 884 | Open in IMG/M |
| 3300006032|Ga0066696_10616192 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300006046|Ga0066652_101304457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300006173|Ga0070716_100773165 | Not Available | 741 | Open in IMG/M |
| 3300006791|Ga0066653_10224698 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 955 | Open in IMG/M |
| 3300006797|Ga0066659_11128299 | Not Available | 656 | Open in IMG/M |
| 3300009012|Ga0066710_103194108 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009012|Ga0066710_103949637 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300009089|Ga0099828_10394972 | Not Available | 1247 | Open in IMG/M |
| 3300009137|Ga0066709_100827715 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1343 | Open in IMG/M |
| 3300009137|Ga0066709_101476261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 983 | Open in IMG/M |
| 3300010043|Ga0126380_10601183 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300010043|Ga0126380_12119487 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010335|Ga0134063_10387585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 684 | Open in IMG/M |
| 3300010361|Ga0126378_12023610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300010362|Ga0126377_10038332 | All Organisms → cellular organisms → Bacteria | 4105 | Open in IMG/M |
| 3300010376|Ga0126381_101386177 | Not Available | 1016 | Open in IMG/M |
| 3300012189|Ga0137388_10613730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1011 | Open in IMG/M |
| 3300012198|Ga0137364_10346528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1108 | Open in IMG/M |
| 3300012200|Ga0137382_11012840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 596 | Open in IMG/M |
| 3300012201|Ga0137365_10080496 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300012208|Ga0137376_10444040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1126 | Open in IMG/M |
| 3300012208|Ga0137376_11710187 | Not Available | 520 | Open in IMG/M |
| 3300012210|Ga0137378_11031833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 736 | Open in IMG/M |
| 3300012210|Ga0137378_11421803 | Not Available | 606 | Open in IMG/M |
| 3300012350|Ga0137372_10507636 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012354|Ga0137366_11015928 | Not Available | 576 | Open in IMG/M |
| 3300012355|Ga0137369_10666122 | Not Available | 718 | Open in IMG/M |
| 3300012357|Ga0137384_11204519 | Not Available | 602 | Open in IMG/M |
| 3300012357|Ga0137384_11254107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300012361|Ga0137360_10083452 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2403 | Open in IMG/M |
| 3300012362|Ga0137361_10491942 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012363|Ga0137390_10478831 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300012917|Ga0137395_10011475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4858 | Open in IMG/M |
| 3300012917|Ga0137395_10047882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2672 | Open in IMG/M |
| 3300012918|Ga0137396_10862623 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 665 | Open in IMG/M |
| 3300012923|Ga0137359_11404442 | Not Available | 586 | Open in IMG/M |
| 3300012960|Ga0164301_10680293 | Not Available | 771 | Open in IMG/M |
| 3300012971|Ga0126369_10910809 | Not Available | 965 | Open in IMG/M |
| 3300012985|Ga0164308_10549283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
| 3300012988|Ga0164306_10591566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 868 | Open in IMG/M |
| 3300013296|Ga0157374_11763306 | Not Available | 644 | Open in IMG/M |
| 3300014325|Ga0163163_10195897 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2068 | Open in IMG/M |
| 3300015261|Ga0182006_1249557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseimicrobium → unclassified Roseimicrobium → Roseimicrobium sp. ORNL1 | 583 | Open in IMG/M |
| 3300015371|Ga0132258_10135697 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5876 | Open in IMG/M |
| 3300015371|Ga0132258_12949597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → unclassified Ktedonobacteraceae → Ktedonobacteraceae bacterium | 1181 | Open in IMG/M |
| 3300016319|Ga0182033_11295204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 654 | Open in IMG/M |
| 3300017657|Ga0134074_1317213 | Not Available | 570 | Open in IMG/M |
| 3300018431|Ga0066655_10015015 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3472 | Open in IMG/M |
| 3300018468|Ga0066662_11051294 | Not Available | 810 | Open in IMG/M |
| 3300019879|Ga0193723_1080125 | Not Available | 936 | Open in IMG/M |
| 3300020006|Ga0193735_1001561 | All Organisms → cellular organisms → Bacteria | 7377 | Open in IMG/M |
| 3300021344|Ga0193719_10018250 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300025922|Ga0207646_10223742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1700 | Open in IMG/M |
| 3300025930|Ga0207701_10082336 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2908 | Open in IMG/M |
| 3300025933|Ga0207706_10750881 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 831 | Open in IMG/M |
| 3300025934|Ga0207686_10400788 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1045 | Open in IMG/M |
| 3300025960|Ga0207651_11316910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 649 | Open in IMG/M |
| 3300025986|Ga0207658_11651065 | Not Available | 586 | Open in IMG/M |
| 3300026324|Ga0209470_1134394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
| 3300026326|Ga0209801_1054733 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1805 | Open in IMG/M |
| 3300026332|Ga0209803_1230873 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 648 | Open in IMG/M |
| 3300026524|Ga0209690_1197223 | Not Available | 645 | Open in IMG/M |
| 3300027875|Ga0209283_10292851 | Not Available | 1075 | Open in IMG/M |
| 3300028768|Ga0307280_10127428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300028768|Ga0307280_10181722 | Not Available | 737 | Open in IMG/M |
| 3300028799|Ga0307284_10111064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1033 | Open in IMG/M |
| 3300028881|Ga0307277_10581696 | Not Available | 503 | Open in IMG/M |
| 3300031715|Ga0307476_10703019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax albus | 749 | Open in IMG/M |
| 3300031716|Ga0310813_10064342 | All Organisms → cellular organisms → Bacteria | 2748 | Open in IMG/M |
| 3300031847|Ga0310907_10710154 | Not Available | 557 | Open in IMG/M |
| 3300032001|Ga0306922_11571671 | Not Available | 655 | Open in IMG/M |
| 3300033412|Ga0310810_10161735 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300033412|Ga0310810_10486929 | Not Available | 1233 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Host-Associated | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03090040 | 2088090014 | Soil | MIYIDDQSSNRTLERTADRRADLLLMTSTLKPAAKLAVVSGRSAQSR |
| INPhiseqgaiiFebDRAFT_1049770572 | 3300000364 | Soil | MFGSNKMLERTADRRMNSFLMTSTLKPEAKLALVSG |
| ARCol0yngRDRAFT_10117262 | 3300000652 | Arabidopsis Rhizosphere | DDQSSNQELERTADRREDLRSMTSILKPAAQLVVVSGRSARFR* |
| JGI10216J12902_1036117831 | 3300000956 | Soil | SNQALERTADRRENLLPMTSTLKPKAQLALVSGRSAFSH* |
| JGI10216J12902_1037717911 | 3300000956 | Soil | LERTADRREDLLSMISAVTFEAQLAAVSGRSACSR* |
| JGI10216J12902_1067152183 | 3300000956 | Soil | MLLRSEQRPNQALERTADRRASLLSMASTLNLEAKLAVVSGR |
| JGI25405J52794_100835461 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MNASNQALERTADRREDLLSMTSTLKTAARLAIVSGHSALSR* |
| Ga0062594_1022325821 | 3300005093 | Soil | EESNQALKRTADRRENLLSMASTLKSEAQLAVVSGRSACFR* |
| Ga0066674_104450831 | 3300005166 | Soil | SNQALERTADRREDLLSMISTLKSAAPLALVSGRSAFSR* |
| Ga0066673_100496594 | 3300005175 | Soil | MGVPEVISNQSNQALERTADRREDLRSMTSTLKAEAQLALVSGRSAFSR* |
| Ga0066688_105153011 | 3300005178 | Soil | SNQTLERTADRREDLLSMISKLNAEAQLALVSGRSALSR* |
| Ga0066684_103520643 | 3300005179 | Soil | SNQALERTADRREVLLLMTSTLKLEARLALVSGRSACSR* |
| Ga0066685_109168661 | 3300005180 | Soil | MNNCWTTNKALERTADRRDNLLSMTSTLKSEAQFALVSGRSASSR* |
| Ga0066675_114275522 | 3300005187 | Soil | PNQALERTADRHANLLFMTSTLEFEALLALVSGRSAFTR* |
| Ga0070662_1014247722 | 3300005457 | Corn Rhizosphere | MIFEPNGSDQALERTADRRDNLLLMTSTLKIEAELAAVSGRSASSR* |
| Ga0070699_1001547455 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLPRGTSNKALERTAYRRDDLLAMTSTLKSEAARALVSGR |
| Ga0070741_100999492 | 3300005529 | Surface Soil | MNSSNQTLERTADRREDLPLMTSTVKPEEKRALVSGRSALSR* |
| Ga0070697_1006264432 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAQESNKALERTADRREDLLSMISALNRDAGRALVSGRSACAR* |
| Ga0070695_1001970811 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSSGIDSRSNQTLERTADRRVSLSLMTSILKPEEKLALVSGRS |
| Ga0066707_100439001 | 3300005556 | Soil | SREFGMEREDQHHDDGPNQALERTADRRANLLSMTSTLNFEAQLAIVSGRSAWSR* |
| Ga0066704_102035344 | 3300005557 | Soil | PNQALERTADRRVNLLLMISTLKPEAQLALVSGRSASSR* |
| Ga0066700_107827782 | 3300005559 | Soil | NQTLERTADRREDLLSMISKLNAEAQLALVSGRSALSR* |
| Ga0066699_108699782 | 3300005561 | Soil | NHALERTADRLANLLSITSTLKLKAQLALGGGRSACSR* |
| Ga0066702_102226281 | 3300005575 | Soil | NQALERTADRRVNLLLMISTLKPEAQLALVSGRSASSR* |
| Ga0066903_1010443003 | 3300005764 | Tropical Forest Soil | MIAAQRKSSNHALERTADRRENLLSMTSTVKREAQLTLVSGR* |
| Ga0081455_101079072 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKRSNQALERTADRREDLRSMTSTLNSEAALAVVSGRSAFSR* |
| Ga0081455_105016533 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTRLFSVVDTTSNQALERTADRREDLLSMTSRLKSEAQFALVSGRSALS |
| Ga0081539_101170393 | 3300005985 | Tabebuia Heterophylla Rhizosphere | RFMKLRSSNQALERTADRCESLLSMTLTLKAKAQLALVSGRSACSR* |
| Ga0081539_102130141 | 3300005985 | Tabebuia Heterophylla Rhizosphere | IVHLHASNLVFEHNSSNQALERTADRRENLLSMTSTLNTEAKRAVVSGRSASSR* |
| Ga0066696_106161923 | 3300006032 | Soil | NQALERTADRRENLLSITSTLKLEAQLALVSGRSASSR* |
| Ga0066652_1013044571 | 3300006046 | Soil | NQSLERTADRRASLLLMTSTLNLEAQLALVSGRSASPR* |
| Ga0070716_1007731651 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LERTADRREDLFSMTSILKPEAELALVSGRSACSR* |
| Ga0066653_102246983 | 3300006791 | Soil | LTKALERTADRREDLLSMISIVKPAAQLALVSGGSALSR* |
| Ga0066659_111282992 | 3300006797 | Soil | PNHALERTADRLANLLSITSTLKLKAQLALGGGRSACSR* |
| Ga0066710_1031941081 | 3300009012 | Grasslands Soil | NQALERTADRREDLLSMTSTLDPEAQLAPVSGRTAWSR |
| Ga0066710_1039496372 | 3300009012 | Grasslands Soil | LERTADRREDLLSMTSTVKPEAQLAVVSGRSALSR |
| Ga0099828_103949721 | 3300009089 | Vadose Zone Soil | NQALERTADRRANLFSMTSTLQTQAQLAAASGGSAPSR* |
| Ga0066709_1008277153 | 3300009137 | Grasslands Soil | ALERTADRRANFLSMTSTLEPKAQPAIVSGRSAFSR* |
| Ga0066709_1014762613 | 3300009137 | Grasslands Soil | MRSNQALERTADRREDLLSMTSILNLEAQPALVSGRSAYSR* |
| Ga0126380_106011831 | 3300010043 | Tropical Forest Soil | QTPNQSLQRTADPREDLLSMTSTVKSEARLALVSGG* |
| Ga0126380_121194872 | 3300010043 | Tropical Forest Soil | ASNQALERTADWRKSFLFMISTLKPKAPRGFVSGRSAPSR* |
| Ga0134063_103875851 | 3300010335 | Grasslands Soil | MNNCWTTNKALERTADRRDNLLSMTSTLKSEAQFALVSGRSASSR |
| Ga0126378_120236101 | 3300010361 | Tropical Forest Soil | MNEEPNQALERTADRRANLLSMISRLKPEAQLALVSGRSA |
| Ga0126377_100383325 | 3300010362 | Tropical Forest Soil | MRSNQALERTADRRENLLSMTSAWKLEAQLALVSGRSACFR* |
| Ga0126381_1013861771 | 3300010376 | Tropical Forest Soil | SNQSLERTADRREDLLSMTSTLKSKAPLALVSGRSVLFR* |
| Ga0137388_106137301 | 3300012189 | Vadose Zone Soil | PNQALERTADRRVNFLSMISTLNREEQFALVSGCSACSR* |
| Ga0137364_103465281 | 3300012198 | Vadose Zone Soil | MKPNQALERTADRRENLFSMTSTLKPEAQLALTSGRSACSR |
| Ga0137382_110128401 | 3300012200 | Vadose Zone Soil | MRPNQTLERTADRRGNLLLMTTTLEPEAELAPASGRSA |
| Ga0137365_100804964 | 3300012201 | Vadose Zone Soil | ASNQTLERTADRREDLRSMTSTPEAEAERALVSGRSAFSR* |
| Ga0137376_104440404 | 3300012208 | Vadose Zone Soil | PNYALERTADRRVDLLSMTSTLKPEAKLAPVSGRSSCSR* |
| Ga0137376_117101871 | 3300012208 | Vadose Zone Soil | MNMSRPNKALERTADRREDLSSMISALTPAARLALVSGRSACSR |
| Ga0137378_110318331 | 3300012210 | Vadose Zone Soil | NASNQALERTADRRESSLSMISTSEPEAQLALVSGRSAFSR* |
| Ga0137378_114218031 | 3300012210 | Vadose Zone Soil | MKLAHSLRYCQSTSPNQTLERTADRREHLLSMTSTLKSEAQLAVVSGRSAFSR* |
| Ga0137372_105076363 | 3300012350 | Vadose Zone Soil | SNQALERTADRREDLLSMTSTVELEAKFGLVSGHSA* |
| Ga0137366_110159281 | 3300012354 | Vadose Zone Soil | NQALERTADRREDLLLMTSTLKSDAPLALVSGRSAWSR* |
| Ga0137369_106661222 | 3300012355 | Vadose Zone Soil | NQPKTSNQSLERTADRSEGLLLMTSTLKAEAQLAVVSGRSALSR* |
| Ga0137384_112045192 | 3300012357 | Vadose Zone Soil | NQALERTADRREDLLSMISTLKSLERLALVSSRSALSR* |
| Ga0137384_112541071 | 3300012357 | Vadose Zone Soil | MRPNQALERTADRRENLLSMISPLNPEAHLALVSG |
| Ga0137360_100834524 | 3300012361 | Vadose Zone Soil | MRSNQALERTADRRVNLLLMTSTLKAEAQLTIVSGRSAYSR* |
| Ga0137361_104919423 | 3300012362 | Vadose Zone Soil | RPNQALEPTADRRENLLSMISTLKPEAQLALASGGSAPSR* |
| Ga0137390_104788313 | 3300012363 | Vadose Zone Soil | LPSALFAQPNQALERTADRRASLLLMTSTLNLEAQLALVSGRSSWSR* |
| Ga0137395_100114754 | 3300012917 | Vadose Zone Soil | MRPNQALERTADRRENLLLITSTLKLEAQLALVSGRSAYSR* |
| Ga0137395_100478824 | 3300012917 | Vadose Zone Soil | MIGSNQALERTTDRRENLFSMSSTLKPEARLVLVSGRSAWSR* |
| Ga0137396_108626231 | 3300012918 | Vadose Zone Soil | MDLIPINVSGSNQALERTADRRERVRSMTSPLNPETLLALVSGRSAYSR |
| Ga0137359_114044421 | 3300012923 | Vadose Zone Soil | PNQALERTADRRKNLLSMTSILKPEAQLALVSGRSACSR* |
| Ga0164301_106802931 | 3300012960 | Soil | EWPWIDDTSNQALERTADRRENSFSMPSTLNPEIELALVSGRSACSR* |
| Ga0126369_109108091 | 3300012971 | Tropical Forest Soil | MHTATPNQTLERTADRRENLLSMTSTPTLEAEFALVGGRSA |
| Ga0164308_105492833 | 3300012985 | Soil | LERTADRRSNFLSMISTLNLEAQLALVSGRSAPSR* |
| Ga0164306_105915663 | 3300012988 | Soil | ERTADRHEDLLSMISTLNSEAQLAVVSGRSAYSR* |
| Ga0157374_117633061 | 3300013296 | Miscanthus Rhizosphere | KRSNQALERTADRREDLFAMISTLKPEAELAIVSGRSACSR* |
| Ga0163163_101958974 | 3300014325 | Switchgrass Rhizosphere | SNQALERTADRRENLLLMISALKFEAQRALVSGRSA* |
| Ga0182006_12495572 | 3300015261 | Rhizosphere | ERTADRREDLLSMTSTLEPEAQLALVSGRSACSR* |
| Ga0132258_1013569710 | 3300015371 | Arabidopsis Rhizosphere | MSNQALERTADRRLELLSMTSTLKSEAQLALVSGRSASSR* |
| Ga0132258_129495971 | 3300015371 | Arabidopsis Rhizosphere | LERTADRREDLRSMTSILKPVAPLVVVSGRTARLR* |
| Ga0132256_1010536192 | 3300015372 | Arabidopsis Rhizosphere | MGIPEVTANRSNQSLERTADRCEDLLSMISTLKSLEQRALVSGRSVHSR |
| Ga0182033_112952041 | 3300016319 | Soil | QTLERTADRRENLLSMTSTLKTEAPLACVSGRSAWSR |
| Ga0134074_13172131 | 3300017657 | Grasslands Soil | MNNCWTTNKALERTADRRDNLLSMTSTLKSEAQFALVSGRSAS |
| Ga0066655_100150151 | 3300018431 | Grasslands Soil | QALERTADRRVNLLLMTSALKPEAQRALVSGRSALSR |
| Ga0066662_110512943 | 3300018468 | Grasslands Soil | QALERTADRRANLLSMTSSLKFQAMLARVSGRSAYSR |
| Ga0193723_10801251 | 3300019879 | Soil | NQALERTADRREHLLSMTSILKLEAQLGVVSGRSACSR |
| Ga0193735_100156113 | 3300020006 | Soil | MQRDLSAMHHDRPNQALERTGDRREDLLSMASTLKSEAQLGVVSGRSASSR |
| Ga0193719_100182501 | 3300021344 | Soil | TLERTADRRENLLLMTSTFKREAQLVLVSGRSASSR |
| Ga0207646_102237425 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FIQMNRKRPNQALERTADGRENLLSMTSTLKRKADLALVSGRSAWSR |
| Ga0207701_100823365 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFEPNGSNQALERTADRRDNLLLMTSTLKIEAELAAVSGRSASSR |
| Ga0207706_107508811 | 3300025933 | Corn Rhizosphere | CGIYPQMIFEPNGSDQALERTADRRDNLLLMTSTLKIEAELAAVSGRSASSR |
| Ga0207686_104007881 | 3300025934 | Miscanthus Rhizosphere | NQALERTADRRDNLLLMTSTLKIEAELAAVSGRSASSR |
| Ga0207651_113169102 | 3300025960 | Switchgrass Rhizosphere | SNQALERTADRRENLLSMTSTLKSEAQIGVVSGRSA |
| Ga0207658_116510652 | 3300025986 | Switchgrass Rhizosphere | QALERTADRRENLLSMTSTLKSEAQLALVSGRSALSR |
| Ga0209470_11343941 | 3300026324 | Soil | VNALIRPNQALERTADRREDLLSMTSTLNSEAQLALVSG |
| Ga0209801_10547331 | 3300026326 | Soil | QHHDDGPNQALERTADRRANLLSMTSTLNFEAQLAIVSGRSAWSR |
| Ga0209803_12308733 | 3300026332 | Soil | MQCETPNQAMERTADRRVNLLLMISTLKPEAQLALVSGRSASSR |
| Ga0209690_11972232 | 3300026524 | Soil | SGFTQASLTRMRSNQTLEQTADRREDLLSMISKLNAEAQLALVSGRSALSR |
| Ga0209283_102928511 | 3300027875 | Vadose Zone Soil | MMMIERPNQALERTADRRANLFSMTSTLQTQAQLAVVSGR |
| Ga0307280_101274283 | 3300028768 | Soil | ALERTADRRENLLLISSTLKLEAQLALVSGRSACSR |
| Ga0307280_101817221 | 3300028768 | Soil | QTPNHALERTADRREDLLSMTSTVNPEAPLALVSGRSASSR |
| Ga0307284_101110643 | 3300028799 | Soil | MITRRPNQALERTADRRENLLLMTSTLKSEAQRGLVS |
| Ga0307277_105816961 | 3300028881 | Soil | QTLERTADRREDLLLITSTLKSEAQLALVSGRSACSR |
| Ga0307476_107030191 | 3300031715 | Hardwood Forest Soil | MKSNKALERTADRREDLLSMTSTLKPQANLAVVSGRSAWSR |
| Ga0310813_100643422 | 3300031716 | Soil | MRKTIPPAAPNQTLQRTADRREHLLSMTSTLNREAQRALVSGRSAFSR |
| Ga0310907_107101542 | 3300031847 | Soil | PNQTLERTADRRENLLSMTSTLKTEAQLAPVSGRSAFSR |
| Ga0306922_115716713 | 3300032001 | Soil | MTSNHALERTADRRKSLLLMTSTMKPEAQPAVVSGRS |
| Ga0310810_101617354 | 3300033412 | Soil | MKSNQVLERTADRREDLLSITSTLKHEAPLALVSGRSAWSR |
| Ga0310810_104869291 | 3300033412 | Soil | NQTLERTADRREDLLSMTSTLKPEAQLALVSGRSACSR |
| ⦗Top⦘ |