


| Basic Information | |
|---|---|
| Family ID | F099681 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.650 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.282 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF03551 | PadR | 3.88 |
| PF00135 | COesterase | 3.88 |
| PF12704 | MacB_PCD | 2.91 |
| PF13545 | HTH_Crp_2 | 1.94 |
| PF00990 | GGDEF | 1.94 |
| PF13519 | VWA_2 | 0.97 |
| PF04851 | ResIII | 0.97 |
| PF12802 | MarR_2 | 0.97 |
| PF01569 | PAP2 | 0.97 |
| PF00903 | Glyoxalase | 0.97 |
| PF00174 | Oxidored_molyb | 0.97 |
| PF02540 | NAD_synthase | 0.97 |
| PF12796 | Ank_2 | 0.97 |
| PF09754 | PAC2 | 0.97 |
| PF13518 | HTH_28 | 0.97 |
| PF00589 | Phage_integrase | 0.97 |
| PF12681 | Glyoxalase_2 | 0.97 |
| PF13683 | rve_3 | 0.97 |
| PF12840 | HTH_20 | 0.97 |
| PF08241 | Methyltransf_11 | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF08240 | ADH_N | 0.97 |
| PF01527 | HTH_Tnp_1 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 3.88 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.88 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 3.88 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 3.88 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.97 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.97 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.94% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.97% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.97% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.97% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1015330702 | 3300000364 | Soil | MLRFAPLRGQPSSLFQAMQSGEQGSRLDVERAASNLLDAPRDAYAVARLEQERTQDQKVERPLEQISL* |
| Ga0062594_1025714422 | 3300005093 | Soil | PPSLFQAMQSGEQGSRFDVEGAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0065705_108610142 | 3300005294 | Switchgrass Rhizosphere | MQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0066388_1055173561 | 3300005332 | Tropical Forest Soil | QAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0070680_1009754752 | 3300005336 | Corn Rhizosphere | MQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDEKVERPL* |
| Ga0070682_1004211792 | 3300005337 | Corn Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPLQ* |
| Ga0068868_1001824533 | 3300005338 | Miscanthus Rhizosphere | MQRGEQGSRFDVERAASDLLDAACDAHAVVGLEQQRTQNQEVERPLEQISL* |
| Ga0070691_104900842 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0070692_108512863 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AMQSGEQGSRFDVERAASNLLDATCDAHAVVWLEQERAQDQKVERPL* |
| Ga0070669_1016416352 | 3300005353 | Switchgrass Rhizosphere | GEQGSRFDVERAASDLLDAACDAHAVVGLEQQRTQNQEVERPLEQISL* |
| Ga0070675_1016496321 | 3300005354 | Miscanthus Rhizosphere | PLRGQPPSLFQAMQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0070708_1005419192 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0066682_106419181 | 3300005450 | Soil | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERAQDQKVERPL* |
| Ga0070706_1021547241 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PSSLFQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0070698_1017315352 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDAHAVVWLEQERTQDQKVERPL* |
| Ga0070697_1007571481 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0070672_1012794452 | 3300005543 | Miscanthus Rhizosphere | GQPPSLFQAMQSGEQGSRFDVERAASNLLDATCDAQAVVWLEQERTQDQKVERPLQ* |
| Ga0070695_1003238503 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVECPL* |
| Ga0070665_1001410233 | 3300005548 | Switchgrass Rhizosphere | MQSGEQGSRFDVERAASNLLDATGDAYAVVWLEQERTQDQKVERPLE* |
| Ga0070702_1010357382 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MQRGEQGSRFDVERAASDLLDAACDAHAVVGLEQQRTQDQEVERPL |
| Ga0068859_1015019212 | 3300005617 | Switchgrass Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDAYAVVRLEQERAQDQKVERPL* |
| Ga0068864_1026741771 | 3300005618 | Switchgrass Rhizosphere | DVERAASNLLDATCDAHAVVWLEQERTQNQKVERPL* |
| Ga0068863_1011430272 | 3300005841 | Switchgrass Rhizosphere | APLRGQPPSLFQAMQSGEQGSRLDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0075364_108638571 | 3300006051 | Populus Endosphere | MQSGEQRSRFDVERAASDLLDATGDAYAVVWLEQERTQDQKVERPL* |
| Ga0075014_1007643061 | 3300006174 | Watersheds | MQSGEQGSRFDVERAASNLLDATCDADTVVWLEQERTQDQKVERPL* |
| Ga0075366_104838002 | 3300006195 | Populus Endosphere | MQCGEQGSRFDVERAARNLLDTACDAYAVVWLKEEGTQYQKVERPLQ* |
| Ga0066660_113224772 | 3300006800 | Soil | FQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVWLEQERT* |
| Ga0075421_1016223402 | 3300006845 | Populus Rhizosphere | PLRGQPPSLFQAMQSGEQGSRFDVERAASNLPDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0075425_1006060391 | 3300006854 | Populus Rhizosphere | FQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERT* |
| Ga0075425_1022508961 | 3300006854 | Populus Rhizosphere | FQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0075425_1022572342 | 3300006854 | Populus Rhizosphere | MQSGEQGSRLDVERAASNLLDAPRDAYAVVWLEQERTQDQKVERSLKQISL* |
| Ga0075434_1016767603 | 3300006871 | Populus Rhizosphere | PSSLFQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERT* |
| Ga0075424_1003676661 | 3300006904 | Populus Rhizosphere | SLFQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVWLEQERTQDQKVERSLKQISL* |
| Ga0075424_1010045622 | 3300006904 | Populus Rhizosphere | QSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKIERTL* |
| Ga0075436_1001314733 | 3300006914 | Populus Rhizosphere | VERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0079218_104779982 | 3300007004 | Agricultural Soil | MQSGEQGSRFDVERAASNLLDATCDAYAVVGLEQERTQNQKVERPLQ* |
| Ga0114942_13568792 | 3300009527 | Groundwater | MQSREQGARLDVERAAGNLLDATRDAYAVVWLEQKRTQDQQVERPL* |
| Ga0137312_10984331 | 3300011400 | Soil | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERSL* |
| Ga0157292_102087812 | 3300012900 | Soil | MQSGEQGSRFDVERAASNLLDATCDAHAVVWLEQERTQNQKVERPL* |
| Ga0157289_102591311 | 3300012903 | Soil | AMQSGEQGSRFDVERAASNLLDATCDADAMVWLKQERTQDQKVERPLQ* |
| Ga0075324_11076591 | 3300014263 | Natural And Restored Wetlands | MQSGEQGTRFDVERAASNLLDATCDANAVVGLEQERTQDQKVERPL* |
| Ga0157380_103512483 | 3300014326 | Switchgrass Rhizosphere | RGKPSSFFQAMQSGEQGSRFDVERAASNLLDAACDAQAVVWLEQERTQDQKVERPL* |
| Ga0180061_10504931 | 3300014861 | Soil | QSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERAQDQKVERPL* |
| Ga0180087_10320031 | 3300014872 | Soil | MQSGEQGSWFDVERAASNLLDATCDADAVVWLEQERTQDQKVERPL* |
| Ga0180086_10168192 | 3300014883 | Soil | PTTILRFAPLRGQPPSLFQAMQSGEQGSRLDVERAASDLLDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0132258_107047736 | 3300015371 | Arabidopsis Rhizosphere | MQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDQKVERSL* |
| Ga0132258_108931071 | 3300015371 | Arabidopsis Rhizosphere | SLFQAMQSGEQGSRFDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0132258_127118571 | 3300015371 | Arabidopsis Rhizosphere | LRPTTILRFAPLRGQPPSLFQAMQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDQKVERPL* |
| Ga0132258_134876273 | 3300015371 | Arabidopsis Rhizosphere | MQGGEQGARFDVERSAGNLLDATRDAYAVVWLEQECTQDQKVERPL* |
| Ga0132258_138621313 | 3300015371 | Arabidopsis Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDADAVVWLEQERTQDQKVERPL* |
| Ga0132256_1017493091 | 3300015372 | Arabidopsis Rhizosphere | SLFQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL* |
| Ga0132257_1039156171 | 3300015373 | Arabidopsis Rhizosphere | APLRGQPPSLFQAMQSGEQGSRFDVERAASNLLDATRDAYAVVWLEQERTQDQKVERSL* |
| Ga0132255_1003147281 | 3300015374 | Arabidopsis Rhizosphere | LAPLRGQPPSLFQAMQSGEQGSRFDVERAESDLLDATCDAYAVVWLEQERTQDQKVERSL |
| Ga0136617_107248201 | 3300017789 | Polar Desert Sand | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKIERPLE |
| Ga0184610_11625791 | 3300017997 | Groundwater Sediment | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0184611_13274601 | 3300018067 | Groundwater Sediment | MQSGEQGSWFDVERAASNLLDATSDAYAVVWLEQERTQDQKVERSL |
| Ga0184635_102312722 | 3300018072 | Groundwater Sediment | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERAQDQKVERPLQ |
| Ga0190274_122149982 | 3300018476 | Soil | MQSGEQGSWFDVERAASNVLDATCDADAVVWLEQERAQDQKVERPL |
| Ga0190271_111438252 | 3300018481 | Soil | MQSGEQGSRFDVERAASNLLNATCDAYAVVWLKQEGTQNQKVERPLQ |
| Ga0190271_112218552 | 3300018481 | Soil | MQSGEQGSRFDVEGAASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0190273_115901421 | 3300018920 | Soil | MQGGEQGARFDVERAARNLLNTTRDADAVVWLEQERTQDQKVQRPL |
| Ga0190273_116773032 | 3300018920 | Soil | GQPPSLFEAMQCGEQGSRLNVERAASHLLDAPCDAHAVVGLKQEGTQDQKVERPLQ |
| Ga0190264_105985202 | 3300019377 | Soil | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQQVERPL |
| Ga0187892_103965812 | 3300019458 | Bio-Ooze | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERAQDQKVERPL |
| Ga0210393_101989301 | 3300021401 | Soil | MQSGEQGSRFDVERAASNVLDATCDADAVVWLEQERTQDQKVERPL |
| Ga0247800_10503482 | 3300023263 | Soil | MQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0247681_10516922 | 3300024310 | Soil | PLRGEPSSLFQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERPL |
| Ga0209640_106729711 | 3300025324 | Soil | VERAASNLLDAPCDAYAVIWLEQERTQDQKVERPL |
| Ga0207643_109635252 | 3300025908 | Miscanthus Rhizosphere | MQRGEQGSRFDVERAASDLLDAACDAHAVVGLEQQRTQDQEVERPLEQISL |
| Ga0207684_115973371 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAPLRGEPSSLFQAMQSGEQGSRLDVERAASNLLDAPRDAYAVVRLEQERTQDQKVERP |
| Ga0207650_117564582 | 3300025925 | Switchgrass Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDAHAVVWLEQERTQNQKVERPL |
| Ga0207659_115376532 | 3300025926 | Miscanthus Rhizosphere | RAAAILRLAPLRGQPPSVFQAMQSGEQGSRFDVERAASNLLDATCDADAVVWLKQERTQDQKVERPLQ |
| Ga0207701_100671833 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDEKVERPL |
| Ga0207644_100430112 | 3300025931 | Switchgrass Rhizosphere | MQSGEQGSRFDVERAASNLLDATCDADAVVWLKQERTQDQKVERPLQ |
| Ga0207669_104412131 | 3300025937 | Miscanthus Rhizosphere | QPPFLFEAMQSGEQGSRLDVERAAGDLLDATCDAHAVVGLEQERAQDQKVERPLEQISL |
| Ga0207651_117161342 | 3300025960 | Switchgrass Rhizosphere | LAPLRGQPPSVFQAMQSGEQGSRFDVERAASNLLDATCDADAMVWLKQERTQDQKVERPL |
| Ga0207677_101515813 | 3300026023 | Miscanthus Rhizosphere | LFEAMQRGEQGSRFDVERAASDLLDAACDAHAVVGLEQQRTQDQEVERPLEQISL |
| Ga0207703_102342282 | 3300026035 | Switchgrass Rhizosphere | MQSGEQGSRFDVERAASNLLDATGDAYAVVWLEQERTQDQKVERPL |
| Ga0207703_115303222 | 3300026035 | Switchgrass Rhizosphere | RFDVERAASDLLDAACDAHAVVGLEQQRTQNQEVERPLEQISL |
| Ga0208291_10214151 | 3300026111 | Natural And Restored Wetlands | MQSGEQGTRFDVERAASNLLDATCDANAVVGLEQERTQDQKVERPL |
| Ga0207675_1013124352 | 3300026118 | Switchgrass Rhizosphere | GQPPSLFQAMQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0207683_104109641 | 3300026121 | Miscanthus Rhizosphere | MQSGEQGSRFDVERAASDLLDAACDAHAVVGLEQERAQDQKVERPLEQISL |
| Ga0209377_13001872 | 3300026334 | Soil | GQPPSLFQAMQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERAQDQKVERPL |
| Ga0209059_12037061 | 3300026527 | Soil | FQAMQSGEQGSRLDVERAASNLLDAPRNAYAVVWLEQERT |
| Ga0209329_11530932 | 3300027605 | Forest Soil | QAMQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0209382_103379681 | 3300027909 | Populus Rhizosphere | AMQSGEQRSRFDVERAASNLLDATCDAHAVVWLEQERTQDQKVERPL |
| Ga0209705_104231731 | 3300027979 | Freshwater Sediment | MQSGEQGSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPLK |
| Ga0268266_112581871 | 3300028379 | Switchgrass Rhizosphere | MQRGEQGSRFDVERAASDLLDAACDAHAVVGLEQQRTQNQEVERPLEQISL |
| Ga0247822_110106912 | 3300028592 | Soil | GSRFDVERAASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0307297_102276742 | 3300028754 | Soil | LRREPPSLFQAMQSGEQGTRLDVERAARNLLDTACDADAVIRLEEEGTQDQKVERPLQ |
| Ga0307310_100351722 | 3300028824 | Soil | MQRGEQGSRFDVERAASNLLDATCDAHAVVWLEQERPQDQKVERPL |
| Ga0299914_101144982 | 3300031228 | Soil | MQSGEQGSRFDVERAASNLLDAACDAYAVVWLEQERTQDQKVERPL |
| Ga0299914_101467472 | 3300031228 | Soil | MQSGEQGSRFDVERAASDLPDATCDAYAVVWLEQERAQDQKVERPL |
| Ga0307506_104278952 | 3300031366 | Soil | PLRGQPPPLFQAMQSGEQGARLDVERAASNLLDATCDAYTVVWLEQERTQDQKVERPL |
| Ga0170819_132418891 | 3300031469 | Forest Soil | MQSGEQGSRFDVERAASNLLDATCDADAVVWLEQERTQDQKVERPL |
| Ga0310813_104207232 | 3300031716 | Soil | MQSGEQGSRLDVERAASDLLDAPRDAYAVVRLEQKRTQDQKIERPL |
| Ga0307468_1022089141 | 3300031740 | Hardwood Forest Soil | MQSGEQGSRLDVERAASNLLNAPRDAYAVVRLEQERTQDQKVERPL |
| Ga0308174_107758571 | 3300031939 | Soil | FFFEPMQSGEQGSRLDVERAAGDLLDVTGDAHAVVGLEQERAQDQKVERPLQQISL |
| Ga0310897_100788741 | 3300032003 | Soil | FQAMQSGEQGSRFDVERAASDLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0307414_115412621 | 3300032004 | Rhizosphere | RFDLERAARNLLNAPSDAYTVVGLEQERTQDQKVERPL |
| Ga0310902_107839382 | 3300032012 | Soil | VERAASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0247829_117671241 | 3300033550 | Soil | GSRFDVERTASNLLDATCDAYAVVWLEQERTQDQKVERPL |
| Ga0370495_0093247_413_553 | 3300034257 | Untreated Peat Soil | MQSGEQGSWFDVERAARNLLDATCDAYAVVWLEQERTQDQKVERPL |
| ⦗Top⦘ |