


| Basic Information | |
|---|---|
| Family ID | F099675 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ESVEVGVHRGLLVDGVFSTADFGLSAQNPSNTAIAVESII |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.83 % |
| % of genes near scaffold ends (potentially truncated) | 94.17 % |
| % of genes from short scaffolds (< 2000 bps) | 60.19 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.786 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil (14.563 % of family members) |
| Environment Ontology (ENVO) | Unclassified (14.563 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 2.91 |
| PF00528 | BPD_transp_1 | 2.91 |
| PF00106 | adh_short | 1.94 |
| PF03449 | GreA_GreB_N | 1.94 |
| PF14099 | Polysacc_lyase | 1.94 |
| PF00005 | ABC_tran | 1.94 |
| PF01408 | GFO_IDH_MocA | 1.94 |
| PF13408 | Zn_ribbon_recom | 0.97 |
| PF00719 | Pyrophosphatase | 0.97 |
| PF00582 | Usp | 0.97 |
| PF01152 | Bac_globin | 0.97 |
| PF00994 | MoCF_biosynth | 0.97 |
| PF13561 | adh_short_C2 | 0.97 |
| PF09334 | tRNA-synt_1g | 0.97 |
| PF00501 | AMP-binding | 0.97 |
| PF13458 | Peripla_BP_6 | 0.97 |
| PF04851 | ResIII | 0.97 |
| PF13462 | Thioredoxin_4 | 0.97 |
| PF02538 | Hydantoinase_B | 0.97 |
| PF01116 | F_bP_aldolase | 0.97 |
| PF10722 | YbjN | 0.97 |
| PF13556 | HTH_30 | 0.97 |
| PF05138 | PaaA_PaaC | 0.97 |
| PF12323 | HTH_OrfB_IS605 | 0.97 |
| PF00903 | Glyoxalase | 0.97 |
| PF01738 | DLH | 0.97 |
| PF02771 | Acyl-CoA_dh_N | 0.97 |
| PF00535 | Glycos_transf_2 | 0.97 |
| PF13565 | HTH_32 | 0.97 |
| PF00117 | GATase | 0.97 |
| PF02541 | Ppx-GppA | 0.97 |
| PF02233 | PNTB | 0.97 |
| PF13466 | STAS_2 | 0.97 |
| PF01253 | SUI1 | 0.97 |
| PF00111 | Fer2 | 0.97 |
| PF12728 | HTH_17 | 0.97 |
| PF00318 | Ribosomal_S2 | 0.97 |
| PF00872 | Transposase_mut | 0.97 |
| PF00115 | COX1 | 0.97 |
| PF04203 | Sortase | 0.97 |
| PF13344 | Hydrolase_6 | 0.97 |
| PF13361 | UvrD_C | 0.97 |
| PF13551 | HTH_29 | 0.97 |
| PF01638 | HxlR | 0.97 |
| PF12900 | Pyridox_ox_2 | 0.97 |
| PF13546 | DDE_5 | 0.97 |
| PF05221 | AdoHcyase | 0.97 |
| PF01261 | AP_endonuc_2 | 0.97 |
| PF03741 | TerC | 0.97 |
| PF00498 | FHA | 0.97 |
| PF08534 | Redoxin | 0.97 |
| PF13751 | DDE_Tnp_1_6 | 0.97 |
| PF02152 | FolB | 0.97 |
| PF11139 | SfLAP | 0.97 |
| PF00391 | PEP-utilizers | 0.97 |
| PF06243 | PaaB | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF01207 | Dus | 0.97 |
| PF01266 | DAO | 0.97 |
| PF01391 | Collagen | 0.97 |
| PF03988 | DUF347 | 0.97 |
| PF00171 | Aldedh | 0.97 |
| PF02913 | FAD-oxidase_C | 0.97 |
| PF03725 | RNase_PH_C | 0.97 |
| PF02894 | GFO_IDH_MocA_C | 0.97 |
| PF02823 | ATP-synt_DE_N | 0.97 |
| PF06662 | C5-epim_C | 0.97 |
| PF06262 | Zincin_1 | 0.97 |
| PF06114 | Peptidase_M78 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.91 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.91 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.91 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.91 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.91 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.91 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.94 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 1.94 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 1.94 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.97 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0023 | Translation initiation factor 1 (eIF-1/SUI1) | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.97 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.97 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.97 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.97 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.97 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.97 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.97 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.97 |
| COG1539 | Dihydroneopterin aldolase | Coenzyme transport and metabolism [H] | 0.97 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.97 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.97 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.97 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.97 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.97 |
| COG3396 | 1,2-phenylacetyl-CoA epoxidase, catalytic subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG3460 | 1,2-phenylacetyl-CoA epoxidase, PaaB subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.97 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.79 % |
| Unclassified | root | N/A | 26.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002461|AADWTP_10038860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3490 | Open in IMG/M |
| 3300005355|Ga0070671_100055947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3282 | Open in IMG/M |
| 3300005532|Ga0070739_10000948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 47708 | Open in IMG/M |
| 3300005532|Ga0070739_10006626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12683 | Open in IMG/M |
| 3300005532|Ga0070739_10029808 | All Organisms → cellular organisms → Bacteria | 4064 | Open in IMG/M |
| 3300005532|Ga0070739_10042855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3069 | Open in IMG/M |
| 3300005535|Ga0070684_100726446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 926 | Open in IMG/M |
| 3300005876|Ga0075300_1078619 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006174|Ga0075014_100907085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300006792|Ga0075530_1025456 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300006792|Ga0075530_1166041 | Not Available | 697 | Open in IMG/M |
| 3300006792|Ga0075530_1168002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300006792|Ga0075530_1206136 | Not Available | 614 | Open in IMG/M |
| 3300006852|Ga0075433_10300822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1420 | Open in IMG/M |
| 3300009162|Ga0075423_11889239 | Not Available | 645 | Open in IMG/M |
| 3300009488|Ga0114925_10343315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea | 1021 | Open in IMG/M |
| 3300009818|Ga0105072_1048229 | Not Available | 808 | Open in IMG/M |
| 3300009840|Ga0126313_10071155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2500 | Open in IMG/M |
| 3300010041|Ga0126312_10102878 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300010041|Ga0126312_10598634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 792 | Open in IMG/M |
| 3300010375|Ga0105239_11486208 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300010379|Ga0136449_100869875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1475 | Open in IMG/M |
| 3300012091|Ga0136625_1086190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1105 | Open in IMG/M |
| 3300012092|Ga0136621_1095579 | Not Available | 1208 | Open in IMG/M |
| 3300012092|Ga0136621_1379426 | Not Available | 547 | Open in IMG/M |
| 3300012093|Ga0136632_10372538 | Not Available | 640 | Open in IMG/M |
| 3300012186|Ga0136620_10117308 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300012187|Ga0136622_10027173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 2443 | Open in IMG/M |
| 3300012187|Ga0136622_10184853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 879 | Open in IMG/M |
| 3300012188|Ga0136618_10262026 | Not Available | 746 | Open in IMG/M |
| 3300012912|Ga0157306_10000029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25679 | Open in IMG/M |
| 3300013104|Ga0157370_10025891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5800 | Open in IMG/M |
| 3300013104|Ga0157370_10058481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3664 | Open in IMG/M |
| 3300014254|Ga0075312_1080368 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300014501|Ga0182024_10025837 | All Organisms → cellular organisms → Bacteria | 10339 | Open in IMG/M |
| 3300014501|Ga0182024_10053497 | Not Available | 6349 | Open in IMG/M |
| 3300014501|Ga0182024_10105736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4079 | Open in IMG/M |
| 3300014501|Ga0182024_12031844 | Not Available | 634 | Open in IMG/M |
| 3300014501|Ga0182024_12146672 | Not Available | 613 | Open in IMG/M |
| 3300014502|Ga0182021_12662285 | Not Available | 601 | Open in IMG/M |
| 3300014838|Ga0182030_10004813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 28834 | Open in IMG/M |
| 3300014838|Ga0182030_10006898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23818 | Open in IMG/M |
| 3300014838|Ga0182030_10697315 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300017787|Ga0183260_10000044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 78989 | Open in IMG/M |
| 3300017787|Ga0183260_10021245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4942 | Open in IMG/M |
| 3300017787|Ga0183260_10348427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 996 | Open in IMG/M |
| 3300017787|Ga0183260_11041636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300017789|Ga0136617_10070043 | Not Available | 3070 | Open in IMG/M |
| 3300018029|Ga0187787_10040402 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300018422|Ga0190265_10014720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6039 | Open in IMG/M |
| 3300018422|Ga0190265_10021488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5163 | Open in IMG/M |
| 3300018422|Ga0190265_11066257 | Not Available | 929 | Open in IMG/M |
| 3300018429|Ga0190272_10000272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 30372 | Open in IMG/M |
| 3300018429|Ga0190272_10004938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6320 | Open in IMG/M |
| 3300018429|Ga0190272_10710369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300025312|Ga0209321_10365704 | Not Available | 686 | Open in IMG/M |
| 3300025721|Ga0209587_1040346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
| 3300025791|Ga0210115_1088352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 634 | Open in IMG/M |
| 3300026552|Ga0209577_10586281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300027773|Ga0209810_1006178 | All Organisms → cellular organisms → Bacteria | 10472 | Open in IMG/M |
| 3300027773|Ga0209810_1022205 | All Organisms → cellular organisms → Bacteria | 4080 | Open in IMG/M |
| 3300027826|Ga0209060_10145349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin2 | 1101 | Open in IMG/M |
| 3300027842|Ga0209580_10384109 | Not Available | 700 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10530368 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027897|Ga0209254_10323083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 1171 | Open in IMG/M |
| 3300028714|Ga0307309_10117900 | Not Available | 648 | Open in IMG/M |
| 3300028824|Ga0307310_10104301 | Not Available | 1265 | Open in IMG/M |
| 3300028828|Ga0307312_10999161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300029943|Ga0311340_11196258 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300029944|Ga0311352_11357914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 535 | Open in IMG/M |
| 3300030007|Ga0311338_11427101 | Not Available | 643 | Open in IMG/M |
| 3300030580|Ga0311355_10370026 | Not Available | 1413 | Open in IMG/M |
| 3300031184|Ga0307499_10048294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1034 | Open in IMG/M |
| 3300031198|Ga0307500_10043545 | Not Available | 1061 | Open in IMG/M |
| 3300031234|Ga0302325_10442825 | Not Available | 1997 | Open in IMG/M |
| 3300031234|Ga0302325_10716274 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300031236|Ga0302324_100634961 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300031236|Ga0302324_102494681 | Not Available | 631 | Open in IMG/M |
| 3300031450|Ga0272433_10002210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 30588 | Open in IMG/M |
| 3300031450|Ga0272433_10009684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10734 | Open in IMG/M |
| 3300031450|Ga0272433_10042833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3520 | Open in IMG/M |
| 3300031473|Ga0272434_1002815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 30583 | Open in IMG/M |
| 3300031525|Ga0302326_10589819 | Not Available | 1656 | Open in IMG/M |
| 3300031525|Ga0302326_11541871 | Not Available | 887 | Open in IMG/M |
| 3300031670|Ga0307374_10009492 | All Organisms → cellular organisms → Bacteria | 14325 | Open in IMG/M |
| 3300031670|Ga0307374_10013746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11139 | Open in IMG/M |
| 3300031670|Ga0307374_10016806 | All Organisms → cellular organisms → Bacteria | 9673 | Open in IMG/M |
| 3300031670|Ga0307374_10029130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6493 | Open in IMG/M |
| 3300031670|Ga0307374_10033916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5812 | Open in IMG/M |
| 3300031670|Ga0307374_10062746 | Not Available | 3644 | Open in IMG/M |
| 3300031670|Ga0307374_10086245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2841 | Open in IMG/M |
| 3300031671|Ga0307372_10004330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22022 | Open in IMG/M |
| 3300031671|Ga0307372_10014045 | All Organisms → cellular organisms → Bacteria | 10297 | Open in IMG/M |
| 3300031671|Ga0307372_10028303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6193 | Open in IMG/M |
| 3300031671|Ga0307372_10028724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6124 | Open in IMG/M |
| 3300031671|Ga0307372_10244508 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300031672|Ga0307373_10172020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1624 | Open in IMG/M |
| 3300031672|Ga0307373_10203898 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300031672|Ga0307373_10528423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300031834|Ga0315290_10166170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1905 | Open in IMG/M |
| 3300032160|Ga0311301_10856705 | Not Available | 1234 | Open in IMG/M |
| 3300032895|Ga0335074_10626064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1064 | Open in IMG/M |
| 3300033818|Ga0334804_062261 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 14.56% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 12.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.77% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.85% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 4.85% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 3.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.91% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater | 0.97% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.97% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002461 | Freshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006792 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025721 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031473 | Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nord | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AADWTP_100388601 | 3300002461 | Freshwater | NGDAESVEVGVHRGLRVGGVVLGTADFDLSALNPVSTAMSVESLI* |
| Ga0070671_1000559471 | 3300005355 | Switchgrass Rhizosphere | AINRSAESVEVGVHRGLSVDGCFSTVDFGLSASNPLPTGIPVESVI* |
| Ga0070739_1000094852 | 3300005532 | Surface Soil | VEVGVHRGLQVDGVFSTADFGLSAKNPSDTAAAVESLI* |
| Ga0070739_100066261 | 3300005532 | Surface Soil | VGVHRGLQVDGVFSTADFGLSAKNPSDTAAAVESLI* |
| Ga0070739_100298087 | 3300005532 | Surface Soil | EVGVHRGLQVDGVFSTADFGLSAKNPSDTAAAVESLI* |
| Ga0070739_100428555 | 3300005532 | Surface Soil | AEKVEVGVHRGLQVDGVVSTADFGLSASNPSNTAATVESLI* |
| Ga0070684_1007264461 | 3300005535 | Corn Rhizosphere | SVEVGVHRGLSVDGCFSTADFGLSASNPSITAAAVESTI* |
| Ga0075300_10786192 | 3300005876 | Rice Paddy Soil | RAINDGAESVEVGVHRGLSVDGCFSTADFGLSASNPSITAIAVESTI* |
| Ga0075014_1009070853 | 3300006174 | Watersheds | AINGDAESVEVGVHRGLRVGDAVCTADFGLSVLNPFATAIAVESII* |
| Ga0075530_10254562 | 3300006792 | Arctic Peat Soil | VHRGLQVDGAVLSTADFDLSAQNPVSTVMSVESLI* |
| Ga0075530_11660411 | 3300006792 | Arctic Peat Soil | GVEVGVHRDLRVSGEPVTADFGPSAQGPFSTDRSVESII* |
| Ga0075530_11680021 | 3300006792 | Arctic Peat Soil | ESVEVGVHRGLQVDGAVLSTADFDLSALNPVSTAMSVESLI* |
| Ga0075530_12061361 | 3300006792 | Arctic Peat Soil | SAESVEVGVHRGLRVDGVLDTADFGLSAFSSFPEVAFLVESII* |
| Ga0075433_103008222 | 3300006852 | Populus Rhizosphere | VHRGLSVDGCFSTADFGLSALKSSITAIAVESTI* |
| Ga0075423_118892391 | 3300009162 | Populus Rhizosphere | VEVGVHRGLSVDGCFSTADFGLSALKSSITAIAVESTI* |
| Ga0114925_103433151 | 3300009488 | Deep Subsurface | NRDAEGVEVGVHRGLRVDGALRTADFGLSVRTPFSTAISVESLI* |
| Ga0105072_10482293 | 3300009818 | Groundwater Sand | VEVGVHRGLRVDGAGDTADFGPSALGPFSAARSVESII* |
| Ga0126313_100711551 | 3300009840 | Serpentine Soil | EQVEVGVHRGLPVDGDLDTADFDHSSTKPSITAPAVESVI* |
| Ga0126312_101028781 | 3300010041 | Serpentine Soil | EVGVHRGLPVDGDLDTADFDHSSTKPSITAPAVESVI* |
| Ga0126312_105986341 | 3300010041 | Serpentine Soil | QVEVGVHRGLPVDGDLDTADFDHSSTKPSITAPAVESVI* |
| Ga0105239_114862082 | 3300010375 | Corn Rhizosphere | VHRGLSVDGCFSTVDFGLSASNPLSTGIPVESLI* |
| Ga0136449_1008698753 | 3300010379 | Peatlands Soil | SGEVGLHRGLQVDGALDTADFGLSDPKPSNTANAVESII* |
| Ga0136625_10861901 | 3300012091 | Polar Desert Sand | RAINGGAESVEVGVQRGLLVDGAVNTADFGLSALCPPVTALAVESTI* |
| Ga0136621_10955791 | 3300012092 | Polar Desert Sand | LTVQRGLLVDGAVNTADFGLSALCPPVTALAVESTI |
| Ga0136621_13794261 | 3300012092 | Polar Desert Sand | VQRGLLVDGAVNTADFGLSALCPPVTALAVESTI* |
| Ga0136632_103725382 | 3300012093 | Polar Desert Sand | RAENGDAESVEVGVHRGLQVDGALDTADFGLSAKNPSNTATAVESTI* |
| Ga0136620_101173083 | 3300012186 | Polar Desert Sand | AESVEVGVQRGLLVDGVVNTADFGLSASNPLITALAVESTI* |
| Ga0136622_100271734 | 3300012187 | Polar Desert Sand | GCAINGGAESVEVGVQRGLLVDGVVNTADFGLSASNPLITALAVESTI* |
| Ga0136622_101848531 | 3300012187 | Polar Desert Sand | GVGVQRALRVDGAVNTADFALFSLCPPVTALAVESTI* |
| Ga0136618_102620261 | 3300012188 | Polar Desert Sand | GGAESVEVGVQRGLLVDGAVNTADFGLSALCPPVTALAVESTI* |
| Ga0157306_100000291 | 3300012912 | Soil | SVEVGVHRGLSVDGCFSTADFGLSALKSSITAFAVESTI* |
| Ga0157370_100258917 | 3300013104 | Corn Rhizosphere | SVEVGVHRGLSVDGCFGTADFGLSASNPSVTALAVESTI* |
| Ga0157370_100584811 | 3300013104 | Corn Rhizosphere | ESVEVGVHRGLSVDGCFGTADFGLSASNPSVTALAVESTI* |
| Ga0075312_10803682 | 3300014254 | Natural And Restored Wetlands | ESVEVGVHRGLSVDGCFSTADFGLSASNPSITAVAVESTI* |
| Ga0182024_1002583711 | 3300014501 | Permafrost | VEVGVHRGLQVDGALDTADFGLSAPKPSNTAHAVESTI* |
| Ga0182024_100534971 | 3300014501 | Permafrost | ESVEVGVHRGLQVDGALDTADFGLSAPKPSNTAHAVESTI* |
| Ga0182024_101057365 | 3300014501 | Permafrost | SVEVGVHRGLQVDGALDTADFGLSAPKPSNTAHAVESTI* |
| Ga0182024_120318441 | 3300014501 | Permafrost | EVGVHRGLQVDGALDTADFGLSAQNPTNTAQAVESII* |
| Ga0182024_121466722 | 3300014501 | Permafrost | SVEVGEQRGLLVDGVLGTADFGLSATNPSNTAPAVESII* |
| Ga0182021_126622851 | 3300014502 | Fen | SVEVGVHRGLRVDGVLDTADFGLSALSSLESMAISVESII* |
| Ga0182030_1000481338 | 3300014838 | Bog | ESVEVGVHRGLQVDGVVRTADFGLSVQNPFATAIAVESII* |
| Ga0182030_100068981 | 3300014838 | Bog | SVEVGVHRGLQVDGVLDTADFDLSVLNPFTTGIPVESII* |
| Ga0182030_106973152 | 3300014838 | Bog | VRCAINGNAESVEVGVHRGLQVDGVVRTADFGLSVQNPFATAIAVESII* |
| Ga0183260_100000444 | 3300017787 | Polar Desert Sand | VLNDGAESVEVGVQRGLLVDGVFDTADFGLSARNPLNTALAVESTI |
| Ga0183260_100212451 | 3300017787 | Polar Desert Sand | SVEVGVHRGLQVDGVLDTADFGLSAKNPPNTATAVESLI |
| Ga0183260_103484271 | 3300017787 | Polar Desert Sand | EVGVHRGLLVDGVFSTADFGLSAPIPSNTATAVESLI |
| Ga0183260_110416361 | 3300017787 | Polar Desert Sand | EKVEVGVHRGLLVDGVFSTADFGLSAPIPSNTATAVESLI |
| Ga0136617_100700431 | 3300017789 | Polar Desert Sand | EVGVQRGLLVDGVVNTADFGLSASNPLITACAVESTI |
| Ga0187787_100404023 | 3300018029 | Tropical Peatland | DINRGAEGVEVGVHRDLRVSGETVTADYGPSAQAPFSTARSVESII |
| Ga0190265_100147207 | 3300018422 | Soil | SVEVGVHRGLSVDGCFSTADFGLSALNPSITVFAVESTI |
| Ga0190265_100214887 | 3300018422 | Soil | ESVEVGVHRGLSVDGCFSTADFGLSALNPSITVFAVESTI |
| Ga0190265_110662571 | 3300018422 | Soil | VEVGVHRGLSVDGCFSTADFGLSALNPSITVFAVESTI |
| Ga0190272_1000027224 | 3300018429 | Soil | ESVEVGVHRGLSVDGCFSTVDFGLSASYPLPTGNSVESII |
| Ga0190272_100049381 | 3300018429 | Soil | EVGVHRGLSVDGCFSTVDFGLSASYPLPTGNSVESII |
| Ga0190272_107103693 | 3300018429 | Soil | SVEVGVHRGLSVDGCFSTVDFGLSASYPLPTGNSVESII |
| Ga0209321_103657041 | 3300025312 | Soil | SVEVGVHRGLQVDGVISTADFGLSAQNPSNTAPAVESTI |
| Ga0209587_10403462 | 3300025721 | Arctic Peat Soil | VHRGLQVDGAVLSTADFDLSAQNPVSTAMSVESLI |
| Ga0210115_10883523 | 3300025791 | Natural And Restored Wetlands | EESVEVGVHRGLLVSDAVDTADFGLSSTNPSNTATAVESLI |
| Ga0209577_105862812 | 3300026552 | Soil | ESVEVGVHRGLLVDGVLDTADFGLSAKNPSNTAPTVESLI |
| Ga0209810_10061781 | 3300027773 | Surface Soil | VGVHRGLQVDGVFSTADFGLSAKNPSDTAAAVESLI |
| Ga0209810_10222051 | 3300027773 | Surface Soil | EVGVHRGLQVDGVFSTADFGLSAKNPSDTAAAVESLI |
| Ga0209060_101453492 | 3300027826 | Surface Soil | AESVEVGVHRGLQVDGALDTADFGLSATNPSNTANTVESTI |
| Ga0209580_103841093 | 3300027842 | Surface Soil | AESVEVGVHRGLLVDGVFGTADFGLSAPNPSNTAIAVESLI |
| (restricted) Ga0255055_105303681 | 3300027881 | Seawater | AINRDAEGVEVGVHRGLRVSGAGSTADFDLSAFNPASTAISVESTI |
| Ga0209254_103230831 | 3300027897 | Freshwater Lake Sediment | ESVEVGVHRGLRVDGALLSTADFDLSARNPVSTAMSVESLI |
| Ga0307309_101179001 | 3300028714 | Soil | ESVEVGVHRGLSVDGCFSTADFGLSALKSSITAFAVESTI |
| Ga0307310_101043011 | 3300028824 | Soil | SVEVGVHRGLSVDGCFSTADFGLSALKSSITAFAVESTI |
| Ga0307312_109991612 | 3300028828 | Soil | EGVEVGVHRGLRADGVLGTVDFDPSASNPGSTAMSVESLI |
| Ga0311340_111962581 | 3300029943 | Palsa | AESVEVGVHRGLQVSGVLGTADFGLSAQNPPTTATAVESLI |
| Ga0311352_113579141 | 3300029944 | Palsa | EIISRAINRDAESVEVGVHRGLQVSGVLGTADFGLSAQNPPTTATAVESLI |
| Ga0311338_114271011 | 3300030007 | Palsa | AESVEVGVHRGLQVDGVFGTADFDLSAQNPSATAQAVESII |
| Ga0311355_103700263 | 3300030580 | Palsa | MQSVEVGVHRGLQVSGVLGTADFGLSAQNPPTTATAVESLI |
| Ga0307499_100482941 | 3300031184 | Soil | ESVEVGVHRGLLVDGDLITADFGLSASNPLPTGIPVESTI |
| Ga0307500_100435451 | 3300031198 | Soil | AESVEVGVHRGLSVDGCFSTADFGLSALNPSITAFAVESTI |
| Ga0302325_104428251 | 3300031234 | Palsa | ESVEVGVHRGLLVDGDFSTADFGLSAQNPSNTAIAVESTI |
| Ga0302325_107162741 | 3300031234 | Palsa | NRDAESVEVGVHRGLQVDGVFGTADFDLSAQNPSATAQAVESII |
| Ga0302324_1006349611 | 3300031236 | Palsa | SCAINRDAESVEVGVHRGLQVDGVFGTADFDLSAQNPSATAQAVESII |
| Ga0302324_1024946811 | 3300031236 | Palsa | ESVEVGVHRGLQVDGVFGTADFDLSAQNPSATAQAVESLI |
| Ga0272433_1000221038 | 3300031450 | Rock | AESVEVGVHRGLLVDEAISTADFGLSAKNPSNTATAVESII |
| Ga0272433_100096841 | 3300031450 | Rock | AESVEVGVHRGLQVDGVLDTADFGLSAKNPPNTATAVESLI |
| Ga0272433_100428331 | 3300031450 | Rock | ESVEVGVHRGLQVDGVLDTADFGLSAKNPPNTATAVESLI |
| Ga0272434_100281538 | 3300031473 | Rock | SVEVGVHRGLLVDEAISTADFGLSAKNPSNTATAVESII |
| Ga0302326_105898191 | 3300031525 | Palsa | ESVEVGVHRGLQVSGVLGTADFGLSAQNPPTTATAVESLI |
| Ga0302326_115418712 | 3300031525 | Palsa | SRAINRDAESVEVGVHRGLQVSGVLGTADFGLSAQNPPTTATAVESLI |
| Ga0307374_100094921 | 3300031670 | Soil | GVHRGLRVDGAFLSTADFDLSVLNPFATGIPVESII |
| Ga0307374_100137461 | 3300031670 | Soil | ESVEVGVHRGLLVDGVLDTADFGLSVENPFATAIAVESII |
| Ga0307374_100168061 | 3300031670 | Soil | ESVEVGVHRGLLVDGVFSTADFGLSAQNPSNTAIAVESII |
| Ga0307374_100291308 | 3300031670 | Soil | TAMHKSVEVGVHRGLQVDGLVSTADFGLSVQNPFATATAVESLI |
| Ga0307374_1003391612 | 3300031670 | Soil | GVHRGLLVDGVVSTADFGLSVENPFATAIAVESLI |
| Ga0307374_100627461 | 3300031670 | Soil | ESVEVGVHRGLLVDGVFSTADFGLSAQNPSNTAIAVESIV |
| Ga0307374_100862451 | 3300031670 | Soil | TAMHKSVEVGVHRGLQVDGLVSTADFGLSVQNPFATATAVESII |
| Ga0307372_1000433021 | 3300031671 | Soil | VHRGLRVDGAFLSTADFDLSVLNPFATGIPVESII |
| Ga0307372_1001404516 | 3300031671 | Soil | VGVHRGLLVDGVFSTADFGLSAQNPSNTAIAVESII |
| Ga0307372_100283031 | 3300031671 | Soil | SDAESVEVGVHRGLLVDGVFSTADFGLSAQNPSNTAIAVESIV |
| Ga0307372_100287247 | 3300031671 | Soil | ESVEVGVHRGLRVDGAFLSTADFDLSVLNPFATGIPVESII |
| Ga0307372_102445081 | 3300031671 | Soil | SVEVGVHRGLQVDGVLDTADFGLSAKNPFNTAPAVESTI |
| Ga0307373_101720201 | 3300031672 | Soil | VGVHRGLRVDGVLDTADFGLSVLNPFAPAIAVESLI |
| Ga0307373_102038981 | 3300031672 | Soil | MHKSVEVGVHRGLQVDGVVSTADFGLSVQNPFATATAVESII |
| Ga0307373_105284232 | 3300031672 | Soil | EVGVHRGLQVDGVLDTADFGLSAKNPFNTAPAVESTI |
| Ga0315290_101661701 | 3300031834 | Sediment | EGVEVGVHPGLSVGGAVRTADFDLSARDPVSTAMSVESLI |
| Ga0311301_108567051 | 3300032160 | Peatlands Soil | RRAINYGAESVEVGVHRGLQVDGALDTADFGLSDPKPSNTPTTVESII |
| Ga0335074_106260641 | 3300032895 | Soil | AESVEVGVHRGLQAGGVLDTADFGLSATNPSNTAPAMESTI |
| Ga0334804_062261_38_187 | 3300033818 | Soil | VRCAINGNAESVEVGVHRGLQVDGVVRTADFGLSVQNPFATAIAVESII |
| ⦗Top⦘ |