


| Basic Information | |
|---|---|
| Family ID | F099599 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVAGFAEVIEREETLVAEACNHPNCLVLPFSLELIRLAA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.77 % |
| % of genes near scaffold ends (potentially truncated) | 45.63 % |
| % of genes from short scaffolds (< 2000 bps) | 82.52 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.641 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.097 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.010 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.427 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF13671 | AAA_33 | 6.80 |
| PF08843 | AbiEii | 1.94 |
| PF13338 | AbiEi_4 | 1.94 |
| PF03576 | Peptidase_S58 | 1.94 |
| PF00248 | Aldo_ket_red | 1.94 |
| PF13427 | DUF4111 | 1.94 |
| PF02687 | FtsX | 1.94 |
| PF08447 | PAS_3 | 1.94 |
| PF01425 | Amidase | 1.94 |
| PF12833 | HTH_18 | 1.94 |
| PF00561 | Abhydrolase_1 | 1.94 |
| PF03401 | TctC | 0.97 |
| PF00106 | adh_short | 0.97 |
| PF12831 | FAD_oxidored | 0.97 |
| PF02604 | PhdYeFM_antitox | 0.97 |
| PF14321 | DUF4382 | 0.97 |
| PF13561 | adh_short_C2 | 0.97 |
| PF06441 | EHN | 0.97 |
| PF03795 | YCII | 0.97 |
| PF01979 | Amidohydro_1 | 0.97 |
| PF00583 | Acetyltransf_1 | 0.97 |
| PF08281 | Sigma70_r4_2 | 0.97 |
| PF14417 | MEDS | 0.97 |
| PF12680 | SnoaL_2 | 0.97 |
| PF00282 | Pyridoxal_deC | 0.97 |
| PF07859 | Abhydrolase_3 | 0.97 |
| PF01042 | Ribonuc_L-PSP | 0.97 |
| PF00903 | Glyoxalase | 0.97 |
| PF04542 | Sigma70_r2 | 0.97 |
| PF05015 | HigB-like_toxin | 0.97 |
| PF13302 | Acetyltransf_3 | 0.97 |
| PF02371 | Transposase_20 | 0.97 |
| PF04389 | Peptidase_M28 | 0.97 |
| PF08031 | BBE | 0.97 |
| PF01638 | HxlR | 0.97 |
| PF02517 | Rce1-like | 0.97 |
| PF14534 | DUF4440 | 0.97 |
| PF09286 | Pro-kuma_activ | 0.97 |
| PF01610 | DDE_Tnp_ISL3 | 0.97 |
| PF13683 | rve_3 | 0.97 |
| PF13531 | SBP_bac_11 | 0.97 |
| PF12697 | Abhydrolase_6 | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF01545 | Cation_efflux | 0.97 |
| PF13817 | DDE_Tnp_IS66_C | 0.97 |
| PF00702 | Hydrolase | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 3.88 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.94 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 1.94 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.97 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.97 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.97 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.97 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.97 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.97 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.97 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.97 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.97 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.97 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.97 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.97 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.64 % |
| Unclassified | root | N/A | 21.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17257370 | All Organisms → cellular organisms → Bacteria | 5228 | Open in IMG/M |
| 3300000955|JGI1027J12803_101104825 | Not Available | 545 | Open in IMG/M |
| 3300001166|JGI12694J13545_1000273 | All Organisms → cellular organisms → Bacteria | 4938 | Open in IMG/M |
| 3300001545|JGI12630J15595_10122937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300001593|JGI12635J15846_10056228 | All Organisms → cellular organisms → Bacteria | 2972 | Open in IMG/M |
| 3300001593|JGI12635J15846_10803596 | Not Available | 539 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100070241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3229 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100386629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1279 | Open in IMG/M |
| 3300002917|JGI25616J43925_10048622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300004082|Ga0062384_100116284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300004092|Ga0062389_104277008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 537 | Open in IMG/M |
| 3300004635|Ga0062388_100984160 | Not Available | 818 | Open in IMG/M |
| 3300005434|Ga0070709_10426508 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005445|Ga0070708_100038406 | All Organisms → cellular organisms → Bacteria | 4182 | Open in IMG/M |
| 3300005467|Ga0070706_100023583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5665 | Open in IMG/M |
| 3300005542|Ga0070732_11036603 | Not Available | 502 | Open in IMG/M |
| 3300005555|Ga0066692_11017378 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005586|Ga0066691_10522872 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005921|Ga0070766_10041011 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300005952|Ga0080026_10022311 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300006050|Ga0075028_100133556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1297 | Open in IMG/M |
| 3300006050|Ga0075028_100781124 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006176|Ga0070765_100201845 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300006176|Ga0070765_100527738 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300006176|Ga0070765_101526612 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006176|Ga0070765_101635122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300006354|Ga0075021_10050917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2394 | Open in IMG/M |
| 3300006354|Ga0075021_10078574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1938 | Open in IMG/M |
| 3300006893|Ga0073928_10000841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 64551 | Open in IMG/M |
| 3300007265|Ga0099794_10321659 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300007788|Ga0099795_10477982 | Not Available | 578 | Open in IMG/M |
| 3300009088|Ga0099830_11092879 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300009090|Ga0099827_10910924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300010343|Ga0074044_10120172 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300011270|Ga0137391_10502074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300012202|Ga0137363_10621384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300012202|Ga0137363_11401930 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012202|Ga0137363_11672391 | Not Available | 529 | Open in IMG/M |
| 3300012203|Ga0137399_11191094 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012207|Ga0137381_11418468 | Not Available | 587 | Open in IMG/M |
| 3300012208|Ga0137376_11366077 | Not Available | 599 | Open in IMG/M |
| 3300012361|Ga0137360_10241696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1479 | Open in IMG/M |
| 3300012362|Ga0137361_10909819 | Not Available | 798 | Open in IMG/M |
| 3300012362|Ga0137361_11641736 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012922|Ga0137394_10226565 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300012922|Ga0137394_10737898 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012925|Ga0137419_10186437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1526 | Open in IMG/M |
| 3300012925|Ga0137419_10588662 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012925|Ga0137419_10782115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 779 | Open in IMG/M |
| 3300012925|Ga0137419_11207704 | Not Available | 633 | Open in IMG/M |
| 3300012925|Ga0137419_11634713 | Not Available | 548 | Open in IMG/M |
| 3300012929|Ga0137404_10171130 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300012929|Ga0137404_10564587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1020 | Open in IMG/M |
| 3300012944|Ga0137410_11589841 | Not Available | 572 | Open in IMG/M |
| 3300014489|Ga0182018_10005489 | All Organisms → cellular organisms → Bacteria | 10187 | Open in IMG/M |
| 3300014495|Ga0182015_10073606 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300019886|Ga0193727_1179693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300019887|Ga0193729_1021602 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
| 3300020170|Ga0179594_10051910 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300020199|Ga0179592_10166966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300020579|Ga0210407_10365954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1128 | Open in IMG/M |
| 3300020579|Ga0210407_10916803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
| 3300020580|Ga0210403_10134045 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300020581|Ga0210399_10959284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 691 | Open in IMG/M |
| 3300020583|Ga0210401_11361910 | Not Available | 567 | Open in IMG/M |
| 3300021171|Ga0210405_10140139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1914 | Open in IMG/M |
| 3300021406|Ga0210386_10318831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Paludibacterium → Paludibacterium purpuratum | 1334 | Open in IMG/M |
| 3300021407|Ga0210383_10586309 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300021420|Ga0210394_10864540 | Not Available | 788 | Open in IMG/M |
| 3300021432|Ga0210384_10535635 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1054 | Open in IMG/M |
| 3300021559|Ga0210409_10678867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300022557|Ga0212123_10066575 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
| 3300022840|Ga0224549_1030126 | Not Available | 737 | Open in IMG/M |
| 3300023259|Ga0224551_1039626 | Not Available | 817 | Open in IMG/M |
| 3300026515|Ga0257158_1028494 | Not Available | 972 | Open in IMG/M |
| 3300026551|Ga0209648_10372367 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300026557|Ga0179587_10391271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 905 | Open in IMG/M |
| 3300026557|Ga0179587_10567286 | Not Available | 746 | Open in IMG/M |
| 3300027587|Ga0209220_1083740 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300027610|Ga0209528_1022591 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300027684|Ga0209626_1045944 | Not Available | 1089 | Open in IMG/M |
| 3300027737|Ga0209038_10113200 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300027842|Ga0209580_10343271 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300027862|Ga0209701_10103983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1772 | Open in IMG/M |
| 3300027879|Ga0209169_10178987 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300027882|Ga0209590_10089025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1820 | Open in IMG/M |
| 3300027889|Ga0209380_10050628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2356 | Open in IMG/M |
| 3300027889|Ga0209380_10143043 | Not Available | 1396 | Open in IMG/M |
| 3300027894|Ga0209068_10238231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300027903|Ga0209488_10596045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 802 | Open in IMG/M |
| 3300028047|Ga0209526_10853751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300028784|Ga0307282_10067671 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300028906|Ga0308309_10753319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300030580|Ga0311355_11583989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum brasilense | 563 | Open in IMG/M |
| 3300030746|Ga0302312_10173248 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300030906|Ga0302314_11324935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300031090|Ga0265760_10187761 | Not Available | 693 | Open in IMG/M |
| 3300031236|Ga0302324_100156421 | All Organisms → cellular organisms → Bacteria | 3725 | Open in IMG/M |
| 3300031708|Ga0310686_100752336 | All Organisms → cellular organisms → Bacteria | 3404 | Open in IMG/M |
| 3300031708|Ga0310686_117444699 | All Organisms → cellular organisms → Bacteria | 4798 | Open in IMG/M |
| 3300031820|Ga0307473_10111232 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300032180|Ga0307471_102426212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300032515|Ga0348332_14006445 | Not Available | 811 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.94% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.97% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.97% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03243200 | 2088090014 | Soil | MVAGFAEVIESEATLVALACNHPNLLVLPFSFELIRLAA |
| JGI1027J12803_1011048252 | 3300000955 | Soil | MVAGFAEVIESEATLVALACNHPNLLVLPFSFELIRLAA* |
| JGI12694J13545_10002737 | 3300001166 | Forest Soil | MVAGFTEVIEREETVVAAACNHPNCLVLPFSLALIRLAA* |
| JGI12630J15595_101229371 | 3300001545 | Forest Soil | AGFVEVVEREEILVAEACNHPNCLVLPFSVELIRLAA* |
| JGI12635J15846_100562283 | 3300001593 | Forest Soil | MVAGFAEAIDREEALVAAACNHPNLLVIPFRALRCAA* |
| JGI12635J15846_108035962 | 3300001593 | Forest Soil | MVAGFAEVIEREETLVAEACNHPNCLVLPFSLELIRLAA* |
| JGIcombinedJ26739_1000702411 | 3300002245 | Forest Soil | MVAGLAEVIDREEALVAEACNHPNCLVLPFSLELIRLAA* |
| JGIcombinedJ26739_1003866292 | 3300002245 | Forest Soil | MVAGFAEVIEIEATLVATDHPNLLVLPFSFELVHAAA* |
| JGI25616J43925_100486223 | 3300002917 | Grasslands Soil | PEPLQIRMVAGFAEVIEREETLVAEACNHPNCLVLPFRLDLVRIAA* |
| Ga0062384_1001162842 | 3300004082 | Bog Forest Soil | MVAGFAEVIEREETLIAAACNHPNCLVLRFSLELIRLAA* |
| Ga0062389_1042770081 | 3300004092 | Bog Forest Soil | MVAGFAEVIEREATLVAEACNHPNCLVLPFRLELIRVAA* |
| Ga0062388_1009841602 | 3300004635 | Bog Forest Soil | MVAGYQEIAERKEILVAGVCNHPNLLVLPFRMELIRFAA* |
| Ga0070709_104265081 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QIRMVAGFAEVIESEATLVALACNHPNCLVLPFRLDLVRLAAQP* |
| Ga0070708_1000384067 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAGFAEVTDREDFLVAWACNHPNLLVIPFRTELIRCAA* |
| Ga0070706_1000235839 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVAGFAEVIEIEETLVAAACNHPNCLVLAFSFPMVRAAA* |
| Ga0070732_110366031 | 3300005542 | Surface Soil | FVEVVEREETLVAEACNHPNCLVLPFRLELIRLAA* |
| Ga0066692_110173782 | 3300005555 | Soil | QIRMVAGFAEAIEREETLVAAACNHLNLLVLPFSLELIRTPA* |
| Ga0066691_105228721 | 3300005586 | Soil | QIRMVAGFAEAIEREETLVAAACNHLNLLVLPFSLELIRTAA* |
| Ga0070766_100410114 | 3300005921 | Soil | MVAGFTEVIESEETLVAEACNHPNCLVIPFSAQLIHCAA* |
| Ga0080026_100223111 | 3300005952 | Permafrost Soil | MVAEFAEVAERKEILVAGVCNHPNCLVLPFKLELIRLAA* |
| Ga0075028_1001335563 | 3300006050 | Watersheds | CGIQIRMVAGFAEAAERKEVLVAGACNHPNCLVLPFRLELIRLAA* |
| Ga0075028_1007811242 | 3300006050 | Watersheds | MVAGFAEVIETEETLVAEACNHPNLLVPPFRLELIRLAA* |
| Ga0070765_1002018454 | 3300006176 | Soil | MVAGFAEVAEGREVLVAAACNHPNCLVLPFSVELIRLAA* |
| Ga0070765_1005277382 | 3300006176 | Soil | MVAGFAEVAERKEILVAGACNHPNLLVIPFRAELIRCAA* |
| Ga0070765_1015266121 | 3300006176 | Soil | KIRMVAGCRELVHRKEQLIAEACNHPNCLVLPFRLELIRLVA* |
| Ga0070765_1016351222 | 3300006176 | Soil | MVAGFAEVIESEATLVALACNHPNLQVIPFRAELIRCAE* |
| Ga0075021_100509173 | 3300006354 | Watersheds | MVAGFAEVIETEETLVAEACNHPNLLVLPFRLELIRLAA* |
| Ga0075021_100785743 | 3300006354 | Watersheds | MVAGFAEVIEKEEFLVAEAYHPNCWVLPFHFPMVRTEGNLAI* |
| Ga0073928_1000084157 | 3300006893 | Iron-Sulfur Acid Spring | MVAGFTEVIESEETLVAAASNHPNCSVLPFRFSMLRPAA* |
| Ga0099794_103216591 | 3300007265 | Vadose Zone Soil | MVAGFAEVIDREATLVAAARNHPNCLVLPFRLELIRLAA* |
| Ga0099795_104779821 | 3300007788 | Vadose Zone Soil | AVPSHRPGRMHLKIRMVAGCRELVHRKEQLIAEACNHPNLLVLPFSLDLIRTAA* |
| Ga0099830_110928792 | 3300009088 | Vadose Zone Soil | MVAGVAEVIEKEEALVAAACNHPNCLVLPFSVELIRLAA* |
| Ga0099827_109109241 | 3300009090 | Vadose Zone Soil | KLSIRMVAGFAEVAERKEILVAGACNHPNCLVLPFSVELIRLAA* |
| Ga0074044_101201722 | 3300010343 | Bog Forest Soil | MVAGFAEVIEREETLIAAACNHPDCLVLRFSLELIRLAA* |
| Ga0137391_105020741 | 3300011270 | Vadose Zone Soil | FLIVCQDGKSKLSIRMVAGFAEVAERKEILVAGACNHPNCLVLPFSVELIRLAA* |
| Ga0137363_106213842 | 3300012202 | Vadose Zone Soil | MVAGFAEAIERKETLVAEAYNHPNCLVLPFKLELIRLAA* |
| Ga0137363_114019301 | 3300012202 | Vadose Zone Soil | GRIPLKIRMVAGCRELVHRKEQLIAEACNHLNLLVIPFRAELIRCAP* |
| Ga0137363_116723912 | 3300012202 | Vadose Zone Soil | MVAGFVEVIEREETLVAEACNHPNCLVLPFRLDLVRIAA* |
| Ga0137399_111910942 | 3300012203 | Vadose Zone Soil | ARVRAWNESLQIRMVAGFAEVIEREETLVAEACNHPNCLVLPFRLELIQFAA* |
| Ga0137381_114184681 | 3300012207 | Vadose Zone Soil | MLDILNKQNHKIRMVAGFAGMIEREETLVAPACNHPNCLVLPFMLELIRLAA* |
| Ga0137376_113660771 | 3300012208 | Vadose Zone Soil | VSIRMVAGFAEVIEREVTLVAAVCNHPNCLVLPFSVQLIRLTA* |
| Ga0137360_102416963 | 3300012361 | Vadose Zone Soil | MVAGFAEAIEREETLVAEAYNHPNCLVLPFKLKLIRLAA* |
| Ga0137361_109098192 | 3300012362 | Vadose Zone Soil | MVAGFAEVIESEETLDAEACNHPNCLVIAFKTVLERRAA* |
| Ga0137361_116417361 | 3300012362 | Vadose Zone Soil | GFAEVIEIEETLVAADCNHPNCLVLPFSFPMVRLAA* |
| Ga0137394_102265653 | 3300012922 | Vadose Zone Soil | ERNAPAPRQDLSIRMVAGSQEVAERKENLVAEACNHPNCLVLPFRLELIQFAA* |
| Ga0137394_107378982 | 3300012922 | Vadose Zone Soil | MVAGFAEVIESEATLVAAFGNHPNCLVLPFRIELIRLVA* |
| Ga0137419_101864371 | 3300012925 | Vadose Zone Soil | MVAGFAEVIESEETLVAAACNHPNCLVLPFRFPMLRAAA* |
| Ga0137419_105886621 | 3300012925 | Vadose Zone Soil | LKIRMVAGCRELVHRKEQLIAEACNHPNLLVLPFSLDLIRTAA* |
| Ga0137419_107821152 | 3300012925 | Vadose Zone Soil | FLATTARVRAWNESLQIRMVAGFAEVIEREETLVAEACNHPNCLVLPFRLELIQFAA* |
| Ga0137419_112077041 | 3300012925 | Vadose Zone Soil | MVLEFAGIAEKNEILVAEACNHPNCLVLPFGVELIRPAA* |
| Ga0137419_116347131 | 3300012925 | Vadose Zone Soil | QTSIQIRMVAGFVEVVEREETLVAEACNHPNLLVIPFRAELIRCAA* |
| Ga0137404_101711302 | 3300012929 | Vadose Zone Soil | MVAGFVEVIEREETLVAAACNHPNCLVIAFKTVLERRAA* |
| Ga0137404_105645873 | 3300012929 | Vadose Zone Soil | MVAGFAEVIEREETLVAEACNHPNCLVLPFRLELIQFAA* |
| Ga0137410_115898413 | 3300012944 | Vadose Zone Soil | MVAGFAEVIEREETLVAEACNHPNCLVLPFSVELIR |
| Ga0182018_100054893 | 3300014489 | Palsa | MAAGYWEIAEKKDRVVAEACNHPNWLVLPFRFELIKPAA* |
| Ga0182015_100736062 | 3300014495 | Palsa | MVAEFAEVIEIEATMVATACNHPNLLVIPFRAELIRCAA* |
| Ga0193727_11796931 | 3300019886 | Soil | QIRIIAAFAEVIEREILVAAACNHPNCLVLPFRFPMLRAAA |
| Ga0193729_10216025 | 3300019887 | Soil | AGFAELIESEATLVAEACNHPNCLVLPFRLDLIRLAA |
| Ga0179594_100519101 | 3300020170 | Vadose Zone Soil | MVAGFAEVIDREATLVAAARNHPNCLVLPFRLELIRLAA |
| Ga0179592_101669662 | 3300020199 | Vadose Zone Soil | MVAGFAEAIERKETLVAEAYNHPNCLVLPFKLELIRLAA |
| Ga0210407_103659541 | 3300020579 | Soil | QRRELQIRMVAGFAEVIEREEALVAEACNHPNLLVIPFQAELIRYAA |
| Ga0210407_109168031 | 3300020579 | Soil | VAGLAEMTEREETLVAEACNHPNCLVLPFRFPMLGAAA |
| Ga0210403_101340452 | 3300020580 | Soil | MVAGFAEVIESEATLVALACNHPNLLVIPFRAELIRCAE |
| Ga0210399_109592841 | 3300020581 | Soil | GSALSIRMVARYSELLGKEQFLVAEACNHPNLLVLPFRLELIRVAA |
| Ga0210401_113619102 | 3300020583 | Soil | MVAGSAEVAERKEILVAGACNHPNCLVLLFSLELIRLAE |
| Ga0210405_101401393 | 3300021171 | Soil | MVAGFAEAIESESEETLVAEACNHPNCLVLPFSVELIRIAA |
| Ga0210386_103188312 | 3300021406 | Soil | MVSSFAEVIDREDTLVAAACNHPNLLVIPFSAELIRCAA |
| Ga0210383_105863091 | 3300021407 | Soil | MVAGSAEVTEREESLVAEACNHPNCLVLPFRLELI |
| Ga0210394_108645401 | 3300021420 | Soil | MVAGLAEMTEREETLVAEACNHPNCLVLPFRFPMLGAAA |
| Ga0210384_105356352 | 3300021432 | Soil | MVAGFAEVIESEATLVALACNHPNLQVIPFRAELIRCAE |
| Ga0210409_106788671 | 3300021559 | Soil | MVAGSVEVIASEESLVAAACNHPNCLVVPFRLELIRLA |
| Ga0212123_100665753 | 3300022557 | Iron-Sulfur Acid Spring | MVAGYSELIRAEQFLVAEACNHPNLLVIPFRAELIRCAA |
| Ga0224549_10301261 | 3300022840 | Soil | MVAGSAEVIESEETLVAAARNQPNCLVLPFSVELIRLAA |
| Ga0224551_10396262 | 3300023259 | Soil | MVAEFAEVIEIEATMVATACNHPNLLVIPFRAELIRCAA |
| Ga0257158_10284942 | 3300026515 | Soil | IRIVAGFAEMIEKEEILVAKAGNHPNCLVLPFSFPMVRVAA |
| Ga0209648_103723672 | 3300026551 | Grasslands Soil | MVAGFAEVIEREETLVAEACNHPNCLVLPFRLELIQFAA |
| Ga0179587_103912711 | 3300026557 | Vadose Zone Soil | VAGFAEVIEREETLVAEACNHPNCLVLPFRLELIQFAA |
| Ga0179587_105672862 | 3300026557 | Vadose Zone Soil | MAAGFAEVIDREETLVAEACNHPNCLVLPFGVELIRPAA |
| Ga0209220_10837402 | 3300027587 | Forest Soil | VAEFAEVTERKEILVAGACNHPNCLVLPFRLELIRLAA |
| Ga0209528_10225912 | 3300027610 | Forest Soil | MVAGFAEVIEREETLVAEACNHPNLLVIPFRAEFIRCAP |
| Ga0209626_10459444 | 3300027684 | Forest Soil | MGAGYSELVAAEWFLVAEACNHPNCLVVPFWLELIRLAA |
| Ga0209038_101132002 | 3300027737 | Bog Forest Soil | MVAGFAEVIEREETLIAAACNHPNCLVLRFSLELIRLAA |
| Ga0209580_103432712 | 3300027842 | Surface Soil | VAGFVEVVEKEATLIAEACNHPNLLVIPFRAELIRCAA |
| Ga0209701_101039831 | 3300027862 | Vadose Zone Soil | MVAKVQEVFETEENLVAGACNHPNLLVLLFRLELI |
| Ga0209169_101789872 | 3300027879 | Soil | MIAGLAEAIDREETLVAAACNHPNCLVLPFRFLMIRAAA |
| Ga0209590_100890251 | 3300027882 | Vadose Zone Soil | KLSIRMVAGFAEVAERKEILVAGACNHPNCLVLPFSVELIRLAA |
| Ga0209380_100506282 | 3300027889 | Soil | LLHGIQIRMVAGFAEVAERKEILVAGACNHPNLLVIPFRAELIRCAA |
| Ga0209380_101430432 | 3300027889 | Soil | LLHGIQIRMVAGFAEVAERKEILVAGACNHPNCLVLPFSWELIRLSA |
| Ga0209068_102382312 | 3300027894 | Watersheds | MVAGFAEVIEKEEFLVAEAYHPNCWVLPFHFPMVRTEGNLAI |
| Ga0209488_105960451 | 3300027903 | Vadose Zone Soil | AWNESLQIRMVAGFAEVIEREETLVAEACNHPNCLVLPFRLELIQFAA |
| Ga0209526_108537512 | 3300028047 | Forest Soil | KPQIRMVAGFADVIDREETLVAEACNHPNLLVLPFRFELIRVTAWTQAAF |
| Ga0307282_100676712 | 3300028784 | Soil | MVAGFAELIESEATLVAEACNHPNCLVLPFSLELIR |
| Ga0308309_107533191 | 3300028906 | Soil | MVAGFAEVAEGREVLVAAACNHPNCLVLPFSVELIRLAA |
| Ga0311355_115839891 | 3300030580 | Palsa | MVAGYTELTETKENLVATACNHPNCLVLPFRFPKVRAAA |
| Ga0302312_101732482 | 3300030746 | Palsa | MVAGSAEVIESEETLVAAARNQPNCLVLPFSVELIRL |
| Ga0302314_113249351 | 3300030906 | Palsa | SAEVIESEETLVAAARNQPNCLVLPFSVELIRLAA |
| Ga0265760_101877612 | 3300031090 | Soil | MVAGFAEVIKREETFVAAACNYPNWLALPFSMELIRLAA |
| Ga0302324_1001564211 | 3300031236 | Palsa | MITGSAELIEKEESLVVAACNDPNCLVLPFRFPMVRTAA |
| Ga0310686_1007523364 | 3300031708 | Soil | MQIRMVAGFTEMMERSETLVAEACNRPNCFVLLLKLELIWLAA |
| Ga0310686_1174446995 | 3300031708 | Soil | MVAGFAKVIEREETLDAEACNHPNCLVLPFSFSVVRVAA |
| Ga0307473_101112321 | 3300031820 | Hardwood Forest Soil | VAGFGEVIEREEPLVAEARNHPNCLVLRFSFPMVRVAA |
| Ga0307471_1024262122 | 3300032180 | Hardwood Forest Soil | MRLCRIQIWMVAGFPEMIESEEILVAEACNHPNLLVIPFRAELIR |
| Ga0348332_140064451 | 3300032515 | Plant Litter | MVAGFAEVIDRKETLVATACNVPNALIIPFRIELFRPAA |
| ⦗Top⦘ |