


| Basic Information | |
|---|---|
| Family ID | F099580 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKLQEGGCGVAGASRDFAGVRSLGDAEQQADHQIAPEQPGELLGK |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.95 % |
| % of genes near scaffold ends (potentially truncated) | 93.20 % |
| % of genes from short scaffolds (< 2000 bps) | 97.09 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.350 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.184 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.748 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.194 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF07366 | SnoaL | 3.88 |
| PF16881 | LIAS_N | 1.94 |
| PF03965 | Penicillinase_R | 1.94 |
| PF00154 | RecA | 1.94 |
| PF00227 | Proteasome | 1.94 |
| PF07690 | MFS_1 | 1.94 |
| PF02585 | PIG-L | 0.97 |
| PF00106 | adh_short | 0.97 |
| PF13432 | TPR_16 | 0.97 |
| PF06421 | LepA_C | 0.97 |
| PF14494 | DUF4436 | 0.97 |
| PF14079 | DUF4260 | 0.97 |
| PF00486 | Trans_reg_C | 0.97 |
| PF13565 | HTH_32 | 0.97 |
| PF03544 | TonB_C | 0.97 |
| PF04986 | Y2_Tnp | 0.97 |
| PF00230 | MIP | 0.97 |
| PF08450 | SGL | 0.97 |
| PF06808 | DctM | 0.97 |
| PF04264 | YceI | 0.97 |
| PF00180 | Iso_dh | 0.97 |
| PF08031 | BBE | 0.97 |
| PF00248 | Aldo_ket_red | 0.97 |
| PF13673 | Acetyltransf_10 | 0.97 |
| PF02594 | DUF167 | 0.97 |
| PF01022 | HTH_5 | 0.97 |
| PF12681 | Glyoxalase_2 | 0.97 |
| PF13358 | DDE_3 | 0.97 |
| PF00069 | Pkinase | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF00881 | Nitroreductase | 0.97 |
| PF01648 | ACPS | 0.97 |
| PF07517 | SecA_DEAD | 0.97 |
| PF01797 | Y1_Tnp | 0.97 |
| PF01464 | SLT | 0.97 |
| PF13473 | Cupredoxin_1 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.88 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 1.94 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.94 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 1.94 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.97 |
| COG0481 | Translation elongation factor EF-4, membrane-bound GTPase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.97 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.97 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.97 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.97 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.97 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.97 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.97 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.35 % |
| Unclassified | root | N/A | 11.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10671978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101517501 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101691084 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 532 | Open in IMG/M |
| 3300002907|JGI25613J43889_10160498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 588 | Open in IMG/M |
| 3300003322|rootL2_10319978 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300005332|Ga0066388_108343779 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005518|Ga0070699_101642266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300005602|Ga0070762_10458829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300005610|Ga0070763_10533066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300005610|Ga0070763_10667352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300005764|Ga0066903_106190075 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005921|Ga0070766_10590715 | Not Available | 745 | Open in IMG/M |
| 3300006086|Ga0075019_10307157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 956 | Open in IMG/M |
| 3300006176|Ga0070765_100787750 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006176|Ga0070765_101629338 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006755|Ga0079222_11451046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus phyllosphaerae | 639 | Open in IMG/M |
| 3300006755|Ga0079222_11871666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300006893|Ga0073928_10196798 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300006954|Ga0079219_11824943 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009137|Ga0066709_100040986 | All Organisms → cellular organisms → Bacteria | 5087 | Open in IMG/M |
| 3300009792|Ga0126374_11430670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 564 | Open in IMG/M |
| 3300010048|Ga0126373_10002009 | All Organisms → cellular organisms → Bacteria | 14810 | Open in IMG/M |
| 3300010048|Ga0126373_11392464 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300010358|Ga0126370_10193248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1530 | Open in IMG/M |
| 3300010358|Ga0126370_12667319 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010360|Ga0126372_10799624 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300010360|Ga0126372_11309885 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010360|Ga0126372_11636889 | Not Available | 683 | Open in IMG/M |
| 3300010360|Ga0126372_11684164 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010361|Ga0126378_11014085 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300010361|Ga0126378_11604887 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300010398|Ga0126383_11483742 | Not Available | 768 | Open in IMG/M |
| 3300010398|Ga0126383_13650354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300012189|Ga0137388_11551125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300012202|Ga0137363_11714812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012685|Ga0137397_11301501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300016341|Ga0182035_10656963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300017933|Ga0187801_10218985 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300017933|Ga0187801_10325897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 628 | Open in IMG/M |
| 3300017942|Ga0187808_10318908 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300018012|Ga0187810_10301069 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300020581|Ga0210399_11114923 | Not Available | 631 | Open in IMG/M |
| 3300020583|Ga0210401_10186413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1931 | Open in IMG/M |
| 3300020583|Ga0210401_10383607 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300020583|Ga0210401_10895872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300021168|Ga0210406_11107535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300021171|Ga0210405_10313358 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300021178|Ga0210408_11386257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021401|Ga0210393_11070477 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300021405|Ga0210387_11034367 | Not Available | 718 | Open in IMG/M |
| 3300021433|Ga0210391_10163930 | Not Available | 1750 | Open in IMG/M |
| 3300021477|Ga0210398_10292553 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300021479|Ga0210410_11151553 | Not Available | 666 | Open in IMG/M |
| 3300021560|Ga0126371_11393491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planotetraspora → Planotetraspora thailandica | 832 | Open in IMG/M |
| 3300021560|Ga0126371_13333559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300022531|Ga0242660_1009878 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300025906|Ga0207699_10252734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1215 | Open in IMG/M |
| 3300025911|Ga0207654_10504705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300025961|Ga0207712_11001168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 741 | Open in IMG/M |
| 3300026015|Ga0208286_1022953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300026300|Ga0209027_1101599 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300026551|Ga0209648_10240325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
| 3300027105|Ga0207944_1021588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300027692|Ga0209530_1055342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
| 3300027842|Ga0209580_10247639 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300027855|Ga0209693_10299055 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300027882|Ga0209590_10604020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300027884|Ga0209275_10142682 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300027889|Ga0209380_10762717 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300027895|Ga0209624_10970355 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300029636|Ga0222749_10400489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300030855|Ga0075374_11254817 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300031057|Ga0170834_107177048 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300031231|Ga0170824_123172389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300031231|Ga0170824_126526034 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031474|Ga0170818_112688646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
| 3300031679|Ga0318561_10725855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 546 | Open in IMG/M |
| 3300031680|Ga0318574_10153880 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300031708|Ga0310686_113837232 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031715|Ga0307476_10270717 | Not Available | 1243 | Open in IMG/M |
| 3300031720|Ga0307469_12029572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300031753|Ga0307477_10104646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1968 | Open in IMG/M |
| 3300031820|Ga0307473_10352200 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031879|Ga0306919_11101984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 605 | Open in IMG/M |
| 3300031880|Ga0318544_10364843 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031897|Ga0318520_10331318 | Not Available | 921 | Open in IMG/M |
| 3300031942|Ga0310916_10878366 | Not Available | 752 | Open in IMG/M |
| 3300031945|Ga0310913_11181105 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031947|Ga0310909_11414182 | Not Available | 556 | Open in IMG/M |
| 3300031954|Ga0306926_11688109 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300031962|Ga0307479_12082060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300032042|Ga0318545_10376360 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300032055|Ga0318575_10400842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 696 | Open in IMG/M |
| 3300032059|Ga0318533_10614056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 798 | Open in IMG/M |
| 3300032063|Ga0318504_10619518 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032091|Ga0318577_10341686 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300032180|Ga0307471_100696785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
| 3300032180|Ga0307471_102838858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300032261|Ga0306920_100353712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2185 | Open in IMG/M |
| 3300032261|Ga0306920_101478266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300032261|Ga0306920_103777862 | Not Available | 554 | Open in IMG/M |
| 3300032770|Ga0335085_11489609 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300033290|Ga0318519_10500371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 732 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_106719782 | 3300001593 | Forest Soil | MKLQEGGCGVAGTSRDFAGARSLGDAEQQADHQIAPEQRGELLGKYGR |
| JGIcombinedJ26739_1015175012 | 3300002245 | Forest Soil | MKLQEGGCGVAGTSRDFAGVRSPDDAEQQADHQIAPEQPGELLGKFGRTACEQAGRLG |
| JGIcombinedJ26739_1016910842 | 3300002245 | Forest Soil | MKLQEGGCGVAGTFRDFAGGRSLGDAEQQADHQIAPEQPGKLLGKF |
| JGI25613J43889_101604982 | 3300002907 | Grasslands Soil | MKLQEGGCCVASTSRDFAGVRSLGDAEQQADHQIAPEQPGELRGKFG |
| rootL2_103199784 | 3300003322 | Sugarcane Root And Bulk Soil | LQKSRRGVTGASRNFPGSRTLGDAEQQAYHQISPEQPGELLGKF |
| Ga0066388_1083437792 | 3300005332 | Tropical Forest Soil | MKLQEGGCRVAGTFSDFAGIRSLGDAEQQADLQIPPEEPR |
| Ga0070699_1016422661 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLQEGGCGVAGTSRDFARVRSLGDAQQQADQQIAPEQPAELLGKFGRTA |
| Ga0070762_104588291 | 3300005602 | Soil | LKEGGCCVAGTSSDFAGVRSLGDTKQQADRQVAPQQPGELLGKFGRTAREQAGRLG |
| Ga0070763_105330661 | 3300005610 | Soil | MKLQEGGRGVAGTYRDFAGVRLLGDAEQQADHQIAPEQPGEL |
| Ga0070763_106673521 | 3300005610 | Soil | MKLQEGGCGVAGTYRDFAGVRSLGNAEQQADHQIAPKQP |
| Ga0066903_1061900752 | 3300005764 | Tropical Forest Soil | MKLQEGGRGVAGTSRDFAGGRSLGDAEQQADLQIAPEQPGELLGKFGRT |
| Ga0070766_105907151 | 3300005921 | Soil | MKLQEGGGGGASSCRDFVGVWSLDDAEEQADHQIAPEQ |
| Ga0075019_103071573 | 3300006086 | Watersheds | MQEGGCSVAGTSRDFARVRSLDDAKQEADQQIAPEHPAELLGKFGRTAREQSG |
| Ga0070765_1007877501 | 3300006176 | Soil | MKLQEGGCGGAGTRRDFAAVRPLGDAEQQADHQIAPEQPGKLL |
| Ga0070765_1016293381 | 3300006176 | Soil | MKLQEGGCGVAGASRDFAGGRSLGDAEQQADHQIAPEQPGKLL |
| Ga0079222_114510462 | 3300006755 | Agricultural Soil | MKLQEGGCGVTGTPGDFAGIRPLGDAEQQIDHQIAP |
| Ga0079222_118716662 | 3300006755 | Agricultural Soil | MGMKLQEGGDGVAGTRGHFTGIRSFGDAEQQADDQIAP |
| Ga0073928_101967981 | 3300006893 | Iron-Sulfur Acid Spring | MKLQEGGCGVTGTSRDFAGVRSLGDAEQQADHQIAPEQ |
| Ga0079219_118249431 | 3300006954 | Agricultural Soil | MELQEGRCGVAGTSRDFAGVRSLGDAEQQADHQMAPEQPGELFGEFVRA |
| Ga0066709_1000409863 | 3300009137 | Grasslands Soil | MKLQEGGCCVAGTPRDFAGGWSLRDPEQQADHQIAPE* |
| Ga0126374_114306701 | 3300009792 | Tropical Forest Soil | MKLQEGGSGIAGTLSDYAGVRSIGDAEQQADLQIAPEQPGELLGKFGRTSCEQSGRLGLG |
| Ga0126373_100020094 | 3300010048 | Tropical Forest Soil | MKLQEGGCCVVGTSCEFAGVRSLGDAEQQADHQIAPEQSDELRGKFGRMACERPDA* |
| Ga0126373_113924641 | 3300010048 | Tropical Forest Soil | MKLQEGGCGVAGTFSDFAGIRSFGDAEQQADLQIPPEEPRELLGKFGWTS |
| Ga0126370_101932481 | 3300010358 | Tropical Forest Soil | MELQEGGCGVAGTSRDFGGGRSLGDAEQQADLQIAP |
| Ga0126370_126673191 | 3300010358 | Tropical Forest Soil | MELEEGGCGVAGTFSDFAGIRSLGNAEQQANLQIAPEQPRELICKFGRASC |
| Ga0126372_107996241 | 3300010360 | Tropical Forest Soil | MKLQEGGCRIAGTSRDFAGLRSLGDAEQQADLQIAPEQPSELLGKFGRTS |
| Ga0126372_113098851 | 3300010360 | Tropical Forest Soil | MKLQECSRSVAGASRDFAGARSVGDAEKQADLQIAPEQPGELLGKFGGAS* |
| Ga0126372_116368891 | 3300010360 | Tropical Forest Soil | MKLQENGCGVAGKLSDFAGARPLGDAEQQIDLQIAPEQSSELLGKFEGWPASSREACA |
| Ga0126372_116841641 | 3300010360 | Tropical Forest Soil | MKLQEGGCGVAGTFSDFAGIRSLGDAQQQADLQIPPEESPELLGKFGW |
| Ga0126378_110140852 | 3300010361 | Tropical Forest Soil | MKLQESGCGVAGTFSDFAGIRSLGDAEQRADLQILPAR* |
| Ga0126378_116048872 | 3300010361 | Tropical Forest Soil | MKLQECSRSVAGASRDFAGARSVGDAEKQADLQIAPEQP |
| Ga0126383_114837421 | 3300010398 | Tropical Forest Soil | MKLQEGGCGVAGTFSDFAGIRSFGDAEQQADLQIPPEKPRELLGKFGWTSCEQ |
| Ga0126383_136503541 | 3300010398 | Tropical Forest Soil | MKFEEGGCGVAGTFSDFTGIGSLGYAEQQADLQIPPEEPCELLGK |
| Ga0137388_115511251 | 3300012189 | Vadose Zone Soil | MKLQEGGCGVTGTSRDFAGVRSLGDAEQQADHQMAPEQPGELLGKFG |
| Ga0137363_117148121 | 3300012202 | Vadose Zone Soil | MKLQEGGSRVAGTSRDFAGVRSRGDAEQQADHQLAPQQPSELLGKFGRTARKQSGR |
| Ga0137397_113015012 | 3300012685 | Vadose Zone Soil | MKLQEGGSRVAGTSRDFAGVRSRGDAEQQADHQLAPQQPSELLGKFGR |
| Ga0182035_106569631 | 3300016341 | Soil | MQLQEGGRGVAGTSSDFAGVRSLGDAEQQADLQIAPE |
| Ga0187801_102189851 | 3300017933 | Freshwater Sediment | LQESGCGGAGTSRDFAGVRSLGDAEQQADHQIAPEQPGELLAKFGRTACEQSGCLG |
| Ga0187801_103258971 | 3300017933 | Freshwater Sediment | MKLQEGGCGVAGASRDFAGVRSLGDAEQQADHQIAPEQPGELLGK |
| Ga0187808_103189082 | 3300017942 | Freshwater Sediment | MKLQEGGRCVAGTSSDFAGGRSLGDAEQQADHQMAPEQP |
| Ga0187810_103010691 | 3300018012 | Freshwater Sediment | MKLQEGSRCVAGTSSGFAGGRSLGDAEQQADHQMAPEQPGELLGKFSRTACEKSRRLGPD |
| Ga0210399_111149232 | 3300020581 | Soil | MKLQEGGCGVAGASRDFAGVRSLGDAEQQADHQIAP |
| Ga0210401_101864131 | 3300020583 | Soil | MKLQEGGCGVAGTSRDFAGVRSLGDAEQQADHQIAPEQPCELLGKLGRTAREQSGRLGL |
| Ga0210401_103836073 | 3300020583 | Soil | MKLQEGGCGVAGTSCDFAGVRSLGDAEQQANNQIAPEQRGE |
| Ga0210401_108958722 | 3300020583 | Soil | MKLQEGGCGIAGTSRDFAGVWSLGDAEQQADHQIAPEQPGELLGKLGRTA |
| Ga0210406_111075352 | 3300021168 | Soil | MKLQESGCGVAGPPRNFAGRRSLDNAEQQADHQIAPKQAGELPGKFYRTA |
| Ga0210405_103133582 | 3300021171 | Soil | MKLQEGGCGVAGTYRDFAGVRSLGDAEQQADQQIAPEQPGKLLGKLGRTACEQS |
| Ga0210408_113862571 | 3300021178 | Soil | MKLQEGGCGVAGTSRDFARARSLGYAEQQADHQIAPEQPGKLLSKFGRTACEQSGVLGP |
| Ga0210393_110704772 | 3300021401 | Soil | MKLQEGGCGVAGTSYDFARVRPLGDTEQQADQQQAPEQPAELFGKFARTPRQQSGR |
| Ga0210387_110343671 | 3300021405 | Soil | MKLQEGGCGVAGTSRDFAAGRLLGDAEQQADHQIAPEQPGKLLAKF |
| Ga0210391_101639303 | 3300021433 | Soil | MKLQKRSGGVAASRRDFPGIRSPGHAEQQADHQIAPQQPAELFGKFGRRAD |
| Ga0210398_102925531 | 3300021477 | Soil | MKLQEGGGGGASSCRDFVGVRSLDDAEEQADHQIAPEQAGELLGKFGGTSPEQS |
| Ga0210410_111515531 | 3300021479 | Soil | MKLQKGGCGVAGTSRDFAGVRSLGDAEQQADHQIA |
| Ga0126371_113934911 | 3300021560 | Tropical Forest Soil | MKLQESGYGVAGTFSDFAGIRSLGDAEQQADLQILPEEPRELLGKFGWTSCEQSGRLGP |
| Ga0126371_133335592 | 3300021560 | Tropical Forest Soil | MKLEEGGCGVAGASRDFALVRSLGDAEEQADQQIAP |
| Ga0242660_10098783 | 3300022531 | Soil | MKLQEGGCGVAGPSRGFARIRSLGDAEQQADHQIVPEQPGELRGKFG |
| Ga0207699_102527341 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLQEGSRGVAGTCLDCAAIRSLGDAEQQADHQIAPEQ |
| Ga0207654_105047051 | 3300025911 | Corn Rhizosphere | MKLKEGGGSIAGTRRDFAWARPLGDAEQQADHQTAPQQPAELFGQFDRMAID |
| Ga0207712_110011682 | 3300025961 | Switchgrass Rhizosphere | MKLKEGGGSIAGTRRDFAWARPLGDAEQQADHQTAPQQPAELFGQFDRMAIDESGRLSL |
| Ga0208286_10229531 | 3300026015 | Rice Paddy Soil | MKLQEGVCGVAGTSRDFAGVRSLGDAEQQTDHQVAPEQPGELPGK |
| Ga0209027_11015992 | 3300026300 | Grasslands Soil | MKLQEGGCCVAGTPRDFAGGWSLRDPEQQADHQIAPE |
| Ga0209648_102403252 | 3300026551 | Grasslands Soil | MKLQEGGCGVAGTSRDFAGVRSLGDAEQQADHQIAPEQ |
| Ga0207944_10215881 | 3300027105 | Forest Soil | EGGCGVAGTSRDFAGVQSLGDAEQQVDHQMAPEQPGELLGKFRRTAREQSGRPGPG |
| Ga0209530_10553421 | 3300027692 | Forest Soil | MKLQEGGRGVAGTSRDFARVRSLGDAKQQADHQIAPEQPGELPGKFGRTACEQS |
| Ga0209580_102476392 | 3300027842 | Surface Soil | LVHHSVARMKLQEGSRCVACTSRDFARVRSLGNAEQQADHQIAPEQSGELLAKFGRTA |
| Ga0209693_102990551 | 3300027855 | Soil | MKLQEGGCGVAGTYRDFAGVRSLGNAEQQADHQIAPEQPRELLGKFRRTPCEQSG |
| Ga0209590_106040201 | 3300027882 | Vadose Zone Soil | MKLQEGGCGVAGTYRDSAGVRSLGDAKQQADHQKAPEQPG |
| Ga0209275_101426822 | 3300027884 | Soil | MKLQEGGCGFAGTPCAFARVRPLGDTEQQADQQQAPEQPAELFGKFARTPRQQSGR |
| Ga0209380_107627172 | 3300027889 | Soil | MFLRLRMKLQEGGCGIVGTCTDFARGGSLGHAEQQADHPIAPEQP |
| Ga0209624_109703551 | 3300027895 | Forest Soil | MKLQEGGRGVTGTACDFALGWSLGDAEQQADHQTAPE |
| Ga0222749_104004891 | 3300029636 | Soil | MKLQEGGCGVAGTSRDFAGVRSLGDAEQQADHQIAPEQP |
| Ga0075374_112548171 | 3300030855 | Soil | MKLQEGGCGVAGTYRDFAGVRSLGDAEQQADQQIAPEQPGELLGKFGRT |
| Ga0170834_1071770482 | 3300031057 | Forest Soil | MKLQEGGCGVAGTYRDFAGVRSLDDAEQKADHQIAPEQPGELLGEFG |
| Ga0170824_1231723891 | 3300031231 | Forest Soil | MKLQENGCGVAGTSRDFAGVRPLGDAEQQADHQIAPEQPGELLSKFGRTA |
| Ga0170824_1265260341 | 3300031231 | Forest Soil | MKLHEGSCCITGTLRDVARARSLSDAEQQADHQSAPEEPGELLGEVDRTTL |
| Ga0170818_1126886461 | 3300031474 | Forest Soil | MKLQEGGCGVAGTYRDFAGVRSLDDAEHQTDHQISPEQTAEL |
| Ga0318561_107258551 | 3300031679 | Soil | LQEGGSGIAGTLSDFAGVRSIGDAEQQADLQIAPEQPGEL |
| Ga0318574_101538801 | 3300031680 | Soil | MKLQEGGCGVAGTFSDFTGIRSLGDAEQQADLQIPPEEPR |
| Ga0310686_1138372322 | 3300031708 | Soil | MKLQEGGRGVASTSCDFAGVRSLGDAEQKVDHQIAPEQPRELLGKFGRTA |
| Ga0307476_102707172 | 3300031715 | Hardwood Forest Soil | MKLQEGGCRVAGTSPDFAGGRSLGDTEQQADHQMAPEQPGELLGKFGRTACEQSGRPGPL |
| Ga0307469_120295721 | 3300031720 | Hardwood Forest Soil | MKLQEGGCGVAGTSRDFAGVRPLGDAEQQADHQIAPEQPGELLGKFGRM |
| Ga0307477_101046464 | 3300031753 | Hardwood Forest Soil | MKLQKGGCGVAGTSRDFAGVRSLGDAEQQADHQIAPEQPGELLGKFAWTA |
| Ga0307473_103522001 | 3300031820 | Hardwood Forest Soil | LQEGGCGVAGTSRDFSGVRSLGDAEQQADHQIAPEQPGELLGKVGRTAREPSGR |
| Ga0306919_111019842 | 3300031879 | Soil | MKLQEGGCGVAGTSGDFAGVWSFGDAKQKADLQIAPE |
| Ga0318544_103648432 | 3300031880 | Soil | LKEGDCGAAGTCRDFARAGSLGDTEQQADQQIAPEQSNEMLGKFGRAAIEQSGFL |
| Ga0318520_103313184 | 3300031897 | Soil | MKLQEGGCGVAGTFSDFAGIRSLGDAEQQADLQIAPE |
| Ga0310916_108783663 | 3300031942 | Soil | MKLQEGGCGVAGTFSDFAGIRSLGDAEQQADLQIA |
| Ga0310913_111811051 | 3300031945 | Soil | MKSQEGACGVAGTCRYFAGIRSLGNAEQQADLQIAPEEPSELLGKFGRTSCEQSGRLSSG |
| Ga0310909_114141821 | 3300031947 | Soil | MKLQEGSCGVAGASHDFVGVRSLGDTEQQADHQIAPKQS |
| Ga0306926_116881091 | 3300031954 | Soil | MELEEGSCGVAGALRDFAGARSLGDAKQQADHQIAP |
| Ga0307479_120820602 | 3300031962 | Hardwood Forest Soil | MKLQEGGCGVAGTSCDFAGVRSLGDAEQQADHQIAPE |
| Ga0318545_103763602 | 3300032042 | Soil | MKVQKSGCSVAGASLDLALVRPLGDAEQQAHHQIAPEQPPELLGQFCRAAIEQSGGLSLLHDV |
| Ga0318575_104008422 | 3300032055 | Soil | MKLQEGGSGIAGTLSDFAGVRSIGDAEQQADLQIAPEQPGELLGKFGRTSCEQSGRLGLG |
| Ga0318533_106140561 | 3300032059 | Soil | MNLQECGCSVAGTSRDFAGGRSLGDAKQQANHQIAPEQAGELRGKVGRSAY |
| Ga0318504_106195181 | 3300032063 | Soil | MKLQEGGCGVAGTFSDFAGIRSLGDAEQQADLQIPPEEPRELLGKFGWTSCD |
| Ga0318577_103416862 | 3300032091 | Soil | MKLQEGGCGVAGTFSDFAGIRSLGDAEQQADLQIPPEEPRELLGKFGRTSCE |
| Ga0307471_1006967851 | 3300032180 | Hardwood Forest Soil | MKLQEGGCGVAGTSRDFAGVRSPDDAEQQADHQIAPEQPGEL |
| Ga0307471_1028388581 | 3300032180 | Hardwood Forest Soil | MKLQEGGCGVAGTYRDFVGVRSLGDAEQQADYQIAPEQPGELLGKFGRTA |
| Ga0306920_1003537125 | 3300032261 | Soil | MKLQEGACGITGTLSDFAGVRSIGDAEQQADLQIAPEQPGELLGKFGR |
| Ga0306920_1014782661 | 3300032261 | Soil | MKVQEGGRGVAGTSRDVASVRSLGDAKQQADLQIAPEQPRELLGKFGRTSC |
| Ga0306920_1037778622 | 3300032261 | Soil | MKSQEGACGVAGTCRDFAGVRPLGDAEQQADLQIAPEQP |
| Ga0335085_114896094 | 3300032770 | Soil | MKLQEGGCGVAGTSLDFAGIRSPGNAQQQANHQMTPEQPGELLRKVGGAAGKQSG |
| Ga0318519_105003711 | 3300033290 | Soil | MVLRDASFRQRMKLQEGGCGVAGKSGGFAGIRSLGYAEQQADHQIVPEQAGELPGKFGRTACE |
| ⦗Top⦘ |