


| Basic Information | |
|---|---|
| Family ID | F099571 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VDLQEKRQLDLAGQVAKVKAQARPWRAIIALVLAVAAA |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.29 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.670 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.748 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.602 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (41.748 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF01184 | Gpr1_Fun34_YaaH | 47.57 |
| PF02627 | CMD | 6.80 |
| PF02254 | TrkA_N | 3.88 |
| PF00834 | Ribul_P_3_epim | 2.91 |
| PF02080 | TrkA_C | 0.97 |
| PF03729 | DUF308 | 0.97 |
| PF04525 | LOR | 0.97 |
| PF00083 | Sugar_tr | 0.97 |
| PF00474 | SSF | 0.97 |
| PF01182 | Glucosamine_iso | 0.97 |
| PF00175 | NAD_binding_1 | 0.97 |
| PF13401 | AAA_22 | 0.97 |
| PF13450 | NAD_binding_8 | 0.97 |
| PF11139 | SfLAP | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 47.57 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 6.80 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 6.80 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 2.91 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.97 |
| COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.67 % |
| Unclassified | root | N/A | 22.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005165|Ga0066869_10107888 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005458|Ga0070681_10427895 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300005530|Ga0070679_101901832 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005617|Ga0068859_100969265 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005764|Ga0066903_104056730 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005764|Ga0066903_107870130 | Not Available | 548 | Open in IMG/M |
| 3300006028|Ga0070717_10193425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1778 | Open in IMG/M |
| 3300006028|Ga0070717_12040282 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006059|Ga0075017_101010759 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006059|Ga0075017_101524202 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006162|Ga0075030_101042528 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006176|Ga0070765_101221124 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006574|Ga0074056_11552895 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006755|Ga0079222_10361365 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300006806|Ga0079220_10204205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300009147|Ga0114129_10574351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1464 | Open in IMG/M |
| 3300010043|Ga0126380_11078326 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010043|Ga0126380_11340365 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010043|Ga0126380_12153522 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010048|Ga0126373_12789528 | Not Available | 545 | Open in IMG/M |
| 3300010359|Ga0126376_10184447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1712 | Open in IMG/M |
| 3300010360|Ga0126372_11864239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 646 | Open in IMG/M |
| 3300010362|Ga0126377_10686368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
| 3300010362|Ga0126377_12091425 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300010376|Ga0126381_105009306 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010398|Ga0126383_13097408 | Not Available | 543 | Open in IMG/M |
| 3300012096|Ga0137389_10341317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1273 | Open in IMG/M |
| 3300012096|Ga0137389_10893782 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012199|Ga0137383_10519514 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012210|Ga0137378_11220349 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012211|Ga0137377_11369805 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012211|Ga0137377_11872587 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012948|Ga0126375_10921582 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012971|Ga0126369_12096044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 653 | Open in IMG/M |
| 3300013306|Ga0163162_11656762 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300014838|Ga0182030_10628786 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300014968|Ga0157379_10603440 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300016270|Ga0182036_10174946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1551 | Open in IMG/M |
| 3300016294|Ga0182041_10022375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3895 | Open in IMG/M |
| 3300016319|Ga0182033_10450252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1098 | Open in IMG/M |
| 3300016319|Ga0182033_11343428 | Not Available | 643 | Open in IMG/M |
| 3300016371|Ga0182034_11749181 | Not Available | 547 | Open in IMG/M |
| 3300016387|Ga0182040_10012858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4383 | Open in IMG/M |
| 3300016387|Ga0182040_11554883 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300017933|Ga0187801_10464689 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300017961|Ga0187778_11164901 | Not Available | 539 | Open in IMG/M |
| 3300017973|Ga0187780_10416018 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300017999|Ga0187767_10323495 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021402|Ga0210385_10435885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 988 | Open in IMG/M |
| 3300021420|Ga0210394_10794501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 827 | Open in IMG/M |
| 3300025928|Ga0207700_10435055 | Not Available | 1154 | Open in IMG/M |
| 3300025928|Ga0207700_11755837 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300026508|Ga0257161_1047672 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300026551|Ga0209648_10622109 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027725|Ga0209178_1133306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 849 | Open in IMG/M |
| 3300027765|Ga0209073_10086788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1086 | Open in IMG/M |
| 3300027765|Ga0209073_10208426 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300030741|Ga0265459_10508786 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300031520|Ga0272428_1376472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300031544|Ga0318534_10334529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 872 | Open in IMG/M |
| 3300031549|Ga0318571_10021023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1709 | Open in IMG/M |
| 3300031561|Ga0318528_10093814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1569 | Open in IMG/M |
| 3300031564|Ga0318573_10408724 | Not Available | 729 | Open in IMG/M |
| 3300031573|Ga0310915_10486261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 877 | Open in IMG/M |
| 3300031668|Ga0318542_10569545 | Not Available | 590 | Open in IMG/M |
| 3300031681|Ga0318572_10195661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1179 | Open in IMG/M |
| 3300031681|Ga0318572_10313928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 927 | Open in IMG/M |
| 3300031713|Ga0318496_10423507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 736 | Open in IMG/M |
| 3300031719|Ga0306917_10053574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2725 | Open in IMG/M |
| 3300031724|Ga0318500_10380518 | Not Available | 700 | Open in IMG/M |
| 3300031748|Ga0318492_10134122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1240 | Open in IMG/M |
| 3300031748|Ga0318492_10273179 | Not Available | 876 | Open in IMG/M |
| 3300031748|Ga0318492_10362873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 759 | Open in IMG/M |
| 3300031764|Ga0318535_10118834 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300031765|Ga0318554_10027595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3022 | Open in IMG/M |
| 3300031765|Ga0318554_10643624 | Not Available | 596 | Open in IMG/M |
| 3300031771|Ga0318546_10249506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1221 | Open in IMG/M |
| 3300031771|Ga0318546_10491802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 860 | Open in IMG/M |
| 3300031771|Ga0318546_10498777 | Not Available | 854 | Open in IMG/M |
| 3300031779|Ga0318566_10232932 | Not Available | 914 | Open in IMG/M |
| 3300031779|Ga0318566_10387587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300031779|Ga0318566_10637142 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031797|Ga0318550_10187401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 999 | Open in IMG/M |
| 3300031797|Ga0318550_10237170 | Not Available | 884 | Open in IMG/M |
| 3300031798|Ga0318523_10260073 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300031798|Ga0318523_10518495 | Not Available | 589 | Open in IMG/M |
| 3300031799|Ga0318565_10130357 | Not Available | 1215 | Open in IMG/M |
| 3300031845|Ga0318511_10311727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
| 3300031879|Ga0306919_10625473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 830 | Open in IMG/M |
| 3300031890|Ga0306925_10044379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4611 | Open in IMG/M |
| 3300031947|Ga0310909_11513212 | Not Available | 534 | Open in IMG/M |
| 3300032008|Ga0318562_10026632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3049 | Open in IMG/M |
| 3300032010|Ga0318569_10546075 | Not Available | 540 | Open in IMG/M |
| 3300032042|Ga0318545_10377422 | Not Available | 511 | Open in IMG/M |
| 3300032043|Ga0318556_10290605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 854 | Open in IMG/M |
| 3300032067|Ga0318524_10044373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2099 | Open in IMG/M |
| 3300032089|Ga0318525_10186582 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300032180|Ga0307471_104234970 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032892|Ga0335081_11152650 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300033290|Ga0318519_10531680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 710 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.97% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066869_101078882 | 3300005165 | Soil | VDLQEKRQLDLAGQVAKVKDQARPWRAIISLVLAVAAAIVSFTAGD |
| Ga0070681_104278952 | 3300005458 | Corn Rhizosphere | VDLQEKRQLDLARQVAKVKDHTRPWRAIIALVLAVAAAIVS |
| Ga0070679_1019018322 | 3300005530 | Corn Rhizosphere | VDLQEKRQLDLARQVAKVKDHTRPWRAIIALVLAVAAAIVSF |
| Ga0068859_1009692651 | 3300005617 | Switchgrass Rhizosphere | VDLQEKRQLDLARQVAKVKDHTRPWRAIIALVLAVAAAIISFT |
| Ga0066903_1040567302 | 3300005764 | Tropical Forest Soil | VDLHEQRQLDEMARQMAKVRARTRPWRAIIALVLAAAAGIVASLA |
| Ga0066903_1078701302 | 3300005764 | Tropical Forest Soil | VDVQEKHQLDLAKQVASVKARARPWRAIIFSVLAVAAA |
| Ga0070717_101934253 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLQEKRQLDLAKQVASVKARARPWRAIIFSVLAVAAAA |
| Ga0070717_120402822 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLHEQRQLDEMARQMAKVRARTRPWRAIIALVLAAAAGIAATLA |
| Ga0075017_1010107592 | 3300006059 | Watersheds | VDLHEQRQLERARQMAKVKARAKPWRSIFLLVLAGAAGITSSAAGR |
| Ga0075017_1015242021 | 3300006059 | Watersheds | VDLQEKRQLDLAAQVTRVKARARPWRAITAGLLAIACGVIS |
| Ga0075030_1010425282 | 3300006162 | Watersheds | VDLQEKRQLDLAAQVTRVKARARPWRAITAGLLAIACGIISW |
| Ga0070765_1012211241 | 3300006176 | Soil | MDLQEKRQLDLAGQVARVRAQARPWRAIITLVLAVAAGIVSW |
| Ga0074056_115528951 | 3300006574 | Soil | VDLQEKRQLDLAGQVAKVKDQARPWRAIIALVLAVAAAIVSFTA |
| Ga0079222_103613653 | 3300006755 | Agricultural Soil | VDLQEKRQLDLARQVAKVKNQARPWRAIIALVLAVAAAI |
| Ga0079220_102042051 | 3300006806 | Agricultural Soil | VDLHEQHQLDMAGQMAKVKARTRPWRAIIALVLAAAAGIVA |
| Ga0114129_105743514 | 3300009147 | Populus Rhizosphere | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAIAA |
| Ga0126380_110783261 | 3300010043 | Tropical Forest Soil | MTVPERIAPVDLQEKRQLDLARQMARVKRHTRPWRSIIA |
| Ga0126380_113403651 | 3300010043 | Tropical Forest Soil | MRRVVPVDLQEKRQLDLARQVAKVKAQARPWRAIIALVLA |
| Ga0126380_121535221 | 3300010043 | Tropical Forest Soil | MRRAVPVDLQEKRQLDLARQVAKVKAQARPWRAIIAL |
| Ga0126373_127895281 | 3300010048 | Tropical Forest Soil | VDLQEKRQLDLVRQAASVRARARPWRAIIFTVLAVAAACASYAFGRD |
| Ga0126376_101844473 | 3300010359 | Tropical Forest Soil | MRRVVPVDLQEKRQLDLARQVAKVKAQARPWRAIIALVL |
| Ga0126372_118642392 | 3300010360 | Tropical Forest Soil | VVDLQEKRQLDLAKQVASVKARARPWRAIIFSVLAVAA |
| Ga0126377_106863683 | 3300010362 | Tropical Forest Soil | MAAPERTVPVDLQEKRQLDLARQVAKVKAHTRPWRSIIALVLAVGA |
| Ga0126377_120914252 | 3300010362 | Tropical Forest Soil | MRRVVPVDLQEKRQLDLARQVAKVKAQARPWRAIIALV |
| Ga0126381_1050093061 | 3300010376 | Tropical Forest Soil | VDVHEQRQLEVARQMARVKARARPWGAIFVLVLAAA |
| Ga0126383_130974081 | 3300010398 | Tropical Forest Soil | VDLREERQLEVARQMAKVKARARPWRAIIALVLAAAAGII |
| Ga0137389_103413173 | 3300012096 | Vadose Zone Soil | VDLQEKRQLDLAKQVASVKARARPWRAIIFSVLAIVAAGASYAFGNDLN |
| Ga0137389_108937822 | 3300012096 | Vadose Zone Soil | VDLHEQRQLERAQQMAKVKARAKPWRSIFLLVLAGAAGITSSAAGRDF |
| Ga0137383_105195141 | 3300012199 | Vadose Zone Soil | MRRVVPVDLQEKRQLDLARQMAKVKDQARPWRAIIALVLAVAAAIVS |
| Ga0137378_112203491 | 3300012210 | Vadose Zone Soil | LHEQRQLDMARQLAEVKARARPWRAIIALVLAAAAGILASIA |
| Ga0137377_113698051 | 3300012211 | Vadose Zone Soil | VDLHEQRQLDMAKQLAEVKARARPWRAIIALVLAAAA |
| Ga0137377_118725871 | 3300012211 | Vadose Zone Soil | VDLHEQRQLDVARQLAEVKARARPWRAIIALVLAAAAGILASTA |
| Ga0126375_109215822 | 3300012948 | Tropical Forest Soil | VDLQEQRQLDLAEQMAKVKERTRPWRAIIALVLAVVAAGV |
| Ga0126369_120960442 | 3300012971 | Tropical Forest Soil | VDLHEQHQLDMAGHVAKVKARTRPWRAIIALVLAAAAGIVASL |
| Ga0163162_116567621 | 3300013306 | Switchgrass Rhizosphere | MRRVVRVDLQEKRQLDLARQVAKVKDHTRPWRAIIALVLAV |
| Ga0182030_106287861 | 3300014838 | Bog | VDLQEKHQIDLTGSVAKVKERARPWRAIIALVLAIAS |
| Ga0157379_106034403 | 3300014968 | Switchgrass Rhizosphere | MRRPVRVDLQEKRQLDLARQVAKVKDHTRPWRAIIALVLAVAAAIVSFTA |
| Ga0182036_101749461 | 3300016270 | Soil | VDLQEKRQLDLSAQVTKVKARARPWRAIIAGLLAIA |
| Ga0182041_100223751 | 3300016294 | Soil | VDLQEKRQLDLARQVAKVKAHTRPWRAIIALILAVLAAIVS |
| Ga0182033_104502523 | 3300016319 | Soil | LYGGIAVDLQEKRQLDVVKQAATVRARARPWRAIIFTVLA |
| Ga0182033_113434281 | 3300016319 | Soil | MDLQEKRQLDLAKQVASVRARTRPWRAIIFTVLAVAAAVASYAFGR |
| Ga0182034_117491812 | 3300016371 | Soil | VDLQEKRQLDVARQVAKVKAQARPWRAIIATVLAVGAAIVSITADSITPN |
| Ga0182040_100128581 | 3300016387 | Soil | VDLQEKRQLDLTKQVASVRERARPWRAIIFSVLAVV |
| Ga0182040_115548831 | 3300016387 | Soil | VDLQEKRQLDLAGQVAMVKSQARPWRAIIALVLAVAAA |
| Ga0187801_104646892 | 3300017933 | Freshwater Sediment | VDLQEKRQLDLANQMASVKARTRPWRAIIFSVLALAAASISYAFG |
| Ga0187778_111649012 | 3300017961 | Tropical Peatland | VDRQEKHQLDLPKDVAAVKARARPWRAIIALILAVAAAGV |
| Ga0187780_104160181 | 3300017973 | Tropical Peatland | VDLQEKRQLDLARQVAKVKDQARPWRSIIAVVLAVAAAVASFTAGDIT |
| Ga0187767_103234952 | 3300017999 | Tropical Peatland | VDLQEKRQLDLAGQVAKVKAQARPWRAIIALVLAVAAA |
| Ga0210385_104358851 | 3300021402 | Soil | VDLQEKRQLDLAKQAASSTARARPWRAILFSVLALAAAG |
| Ga0210394_107945011 | 3300021420 | Soil | VDLQEKRQLDLAKQAASSTARARPWRAILFSVLALAAAGV |
| Ga0207700_104350552 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLHEQRQLDEMARQMAKVKARTRPWRAIIALVLAVAAGIVASAAG |
| Ga0207700_117558371 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLHEQRQLEVARQMAKVKARARPWRAIIALMLAAAA |
| Ga0257161_10476722 | 3300026508 | Soil | VDLQEKRQHDIAGQMARVKRRAKPWRSIIAAVLAVLA |
| Ga0209648_106221092 | 3300026551 | Grasslands Soil | VDLHEQRQLERAQQMAKVKARAKPWRSIFLLVLAGAAGITSSAAGRDFQYWTGHG |
| Ga0209178_11333063 | 3300027725 | Agricultural Soil | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAIA |
| Ga0209073_100867883 | 3300027765 | Agricultural Soil | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAIAAACVS |
| Ga0209073_102084261 | 3300027765 | Agricultural Soil | VDLHEQHQLDMAGQMAKVKARTRPWRAIIALVLAAAAGI |
| Ga0265459_105087861 | 3300030741 | Soil | VDLHEQRQLEMARQVAKVKARTRPWRAIIALVLAVAAGILAS |
| Ga0265459_113745222 | 3300030741 | Soil | VDLKEKRQLDVAEHVAKVKARARPWRSIIALVIAIDK |
| Ga0272428_13764722 | 3300031520 | Rock | VDLQEKHQIDLAGPVVRATDRVRPWRAIIALVLSVA |
| Ga0318534_103345291 | 3300031544 | Soil | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAV |
| Ga0318571_100210231 | 3300031549 | Soil | VDLQEKRQLDVARQVAGVKARARPWRAIIFTVLAIVAAG |
| Ga0318528_100938143 | 3300031561 | Soil | VDLQERHQLDLASQVAGVKARARPWRAIIFTVLAVVAAGIS |
| Ga0318573_104087242 | 3300031564 | Soil | MDLQEKRRLDLAKQVAGVRARTRPWRAIIFTVLAI |
| Ga0310915_104862612 | 3300031573 | Soil | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAVAAAC |
| Ga0318542_105695452 | 3300031668 | Soil | VDLQEEHQPKLTEQVAKVKVRTRPWRAIIALGLAIAAAGVSWAFGHKMK |
| Ga0318572_101956612 | 3300031681 | Soil | VDLQEKRQLDLAAQVTRVKTHARPWRAIIAGLLAIVCGILSWHAGQH |
| Ga0318572_103139281 | 3300031681 | Soil | VDLQEKRQLDLAKHAASVKARARPWRAIIFTVLAAC |
| Ga0318496_104235072 | 3300031713 | Soil | VDLKEKRQLDLVNQAASVRARARPWRAIIFTALAIAAACVSYVF |
| Ga0306917_100535741 | 3300031719 | Soil | VDLQEKRQLDLTKQVASVRERARPWRAIIFSVLAVVAGAVSY |
| Ga0318500_103805182 | 3300031724 | Soil | MDLQEKRRLDLAKQVAGVRARTRPWRAIIFTVLAIAAAVISYAF |
| Ga0318492_101341223 | 3300031748 | Soil | VDLQEKRQLDLVRQAASVRARARPWRAIIFTVLALAAAFT |
| Ga0318492_102731791 | 3300031748 | Soil | VDLQEEHQPKLTEQVAKVKVRTRPWRAIIALGLAIAAAGVSWAFGHKMKNL |
| Ga0318492_103628732 | 3300031748 | Soil | VDLQEKRQLDRGAQPAGVKARVRPWRVIIFSVLAIVA |
| Ga0318535_101188341 | 3300031764 | Soil | VDLQEKRQLDLSAQVTKVKARARPWRAIIAGLLAIACGILS |
| Ga0318554_100275954 | 3300031765 | Soil | VDLQEKRQLDLAKHAASVKARARPWRAIIFTVLAVAAAFASWAFGRDLK |
| Ga0318554_106436241 | 3300031765 | Soil | VDLQEKRQLDLVRQAASVRARARPWRAIIFAVLALAAAFASYAFGRD |
| Ga0318526_100314431 | 3300031769 | Soil | VDLQERRQLDAARAREQVAKVKARARPWRAIFALVVAV |
| Ga0318546_102495061 | 3300031771 | Soil | VDLQEKRQLDLAKHAASVKARARPWRAIIFTVLAVAAAFASYAFGRDLKSL |
| Ga0318546_104918021 | 3300031771 | Soil | VDLQEKRQLDLTKQVASVRERARPWRAIIFSVLAVVAGAVSYVSG |
| Ga0318546_104987771 | 3300031771 | Soil | VDLQEEHQPKLTEQVAKVKVRTRPWRAIIALGLAIAAAGVSWAFGHK |
| Ga0318566_102329321 | 3300031779 | Soil | VDLQEKRQLELAKQLASVKARTRPWRAIIFTVLAVAAAV |
| Ga0318566_103875872 | 3300031779 | Soil | VDLKEKRQLDLVNQAASVRARARPWRAIIFTALAIAAACVSY |
| Ga0318566_106371421 | 3300031779 | Soil | VDLHEQRQLDEMARQMAKVKSRTRPWQAIIALVLA |
| Ga0318557_101157281 | 3300031795 | Soil | VDLQERRQLDAAREQMSKVKARARPWRAIFFLILAV |
| Ga0318550_101874011 | 3300031797 | Soil | VDLQEKRQLDLAKHAASVKARARPWRAIIFTVLAVAAAFASWAFG |
| Ga0318550_102371702 | 3300031797 | Soil | VDLQEKRQLDLAKQVAHVKARARPWRAIIFLVLALA |
| Ga0318523_102600732 | 3300031798 | Soil | VDLQEKRQLDLARQVARVKDHARPWRAIIALVFAVAAA |
| Ga0318523_105184951 | 3300031798 | Soil | VDLQEKRQLDLARQVAGVKARARPWRAIIFTVLAIAAAGV |
| Ga0318565_101303571 | 3300031799 | Soil | VDLQEQRQLDLAKRMATVKARTRPWRAIIALVLAVVA |
| Ga0318511_103117271 | 3300031845 | Soil | VDLQEKRQLDLAKHAASVKARARPWRAIIFTVLAVAAAFASWAFGRD |
| Ga0306919_106254731 | 3300031879 | Soil | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAVAAGCASFAF |
| Ga0306925_100443791 | 3300031890 | Soil | VDLHEQRQLDEMARQMAKVKARTRPWQAIIALVLAAAA |
| Ga0310909_115132122 | 3300031947 | Soil | VDLQEKRQLDLARQVAKVKAHTRPWRAIIALILAVLA |
| Ga0318562_100266324 | 3300032008 | Soil | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAIGAACVS |
| Ga0318569_105460752 | 3300032010 | Soil | MDLQEKRQLDLAKQVASVRARTRPWRAIIFTVLAIAAAVVSYAFGRHL |
| Ga0318545_103774221 | 3300032042 | Soil | VDLQEKRQLDLVKQAASVRARARPWRAIIFTVLAVAAACASYA |
| Ga0318556_102906052 | 3300032043 | Soil | VDLQEKRQLDVARQVAGVKARARPWRAIIFTVLAIVAAGTSYA |
| Ga0318524_100443731 | 3300032067 | Soil | VDLQERHQLDLASQVAGVKARARPWRAIIFTVLAVVAAGISYA |
| Ga0318525_101865821 | 3300032089 | Soil | VDLQEKRQLDLARQVAKVKAHTRPWRAIIALILAVLAAIVSVAA |
| Ga0307471_1042349702 | 3300032180 | Hardwood Forest Soil | VDLQEQRQLDLAKQMAKVKERTRPWRAIIALVLATVAAG |
| Ga0335081_111526502 | 3300032892 | Soil | VDLQEKRQLDLARQMAKVKDQARPWRAIIALVLAVAAAFVSFT |
| Ga0318519_105316802 | 3300033290 | Soil | VDLQEKRQLDLARQVAGVKARARPWRAIIFTVLAIAAAGVSF |
| ⦗Top⦘ |