


| Basic Information | |
|---|---|
| Family ID | F099568 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 39 residues |
| Representative Sequence | AMRADPAFQEALKSEQANKLVEKIDSTYMRPADFSPMK |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.77 % |
| % of genes near scaffold ends (potentially truncated) | 89.32 % |
| % of genes from short scaffolds (< 2000 bps) | 89.32 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.583 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (12.621 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.039 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.282 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.76% β-sheet: 0.00% Coil/Unstructured: 74.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF12704 | MacB_PCD | 5.83 |
| PF14329 | DUF4386 | 4.85 |
| PF03551 | PadR | 3.88 |
| PF05163 | DinB | 2.91 |
| PF12867 | DinB_2 | 2.91 |
| PF00578 | AhpC-TSA | 1.94 |
| PF07045 | DUF1330 | 1.94 |
| PF07978 | NIPSNAP | 1.94 |
| PF02517 | Rce1-like | 1.94 |
| PF00072 | Response_reg | 0.97 |
| PF00756 | Esterase | 0.97 |
| PF06441 | EHN | 0.97 |
| PF02812 | ELFV_dehydrog_N | 0.97 |
| PF02567 | PhzC-PhzF | 0.97 |
| PF01042 | Ribonuc_L-PSP | 0.97 |
| PF16576 | HlyD_D23 | 0.97 |
| PF00118 | Cpn60_TCP1 | 0.97 |
| PF00535 | Glycos_transf_2 | 0.97 |
| PF01402 | RHH_1 | 0.97 |
| PF02371 | Transposase_20 | 0.97 |
| PF04191 | PEMT | 0.97 |
| PF08818 | DUF1801 | 0.97 |
| PF01341 | Glyco_hydro_6 | 0.97 |
| PF04389 | Peptidase_M28 | 0.97 |
| PF13533 | Biotin_lipoyl_2 | 0.97 |
| PF12681 | Glyoxalase_2 | 0.97 |
| PF13649 | Methyltransf_25 | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF00857 | Isochorismatase | 0.97 |
| PF13437 | HlyD_3 | 0.97 |
| PF16483 | Glyco_hydro_64 | 0.97 |
| PF01047 | MarR | 0.97 |
| PF13282 | DUF4070 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 3.88 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.88 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 3.88 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.91 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.94 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.94 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.97 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.97 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.97 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.97 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.97 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.97 |
| COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 0.97 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.55 % |
| Unclassified | root | N/A | 18.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_104969265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10084409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300001593|JGI12635J15846_10225485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1220 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100011528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7230 | Open in IMG/M |
| 3300004082|Ga0062384_100644393 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300004635|Ga0062388_102398055 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005541|Ga0070733_10931679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300005542|Ga0070732_10025776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 3331 | Open in IMG/M |
| 3300005591|Ga0070761_10131202 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300005591|Ga0070761_10806849 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005610|Ga0070763_10558037 | Not Available | 660 | Open in IMG/M |
| 3300005712|Ga0070764_10198164 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005712|Ga0070764_10669550 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005764|Ga0066903_107482808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300006162|Ga0075030_101165394 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006176|Ga0070765_101328386 | Not Available | 678 | Open in IMG/M |
| 3300006176|Ga0070765_102130411 | Not Available | 524 | Open in IMG/M |
| 3300009088|Ga0099830_10516952 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300009521|Ga0116222_1522054 | Not Available | 520 | Open in IMG/M |
| 3300009624|Ga0116105_1235371 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009645|Ga0116106_1287459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300009665|Ga0116135_1454328 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009665|Ga0116135_1459241 | Not Available | 524 | Open in IMG/M |
| 3300009698|Ga0116216_10651708 | Not Available | 633 | Open in IMG/M |
| 3300009759|Ga0116101_1004854 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300009762|Ga0116130_1080577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300009792|Ga0126374_11764694 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010048|Ga0126373_11466595 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010343|Ga0074044_10493689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300010358|Ga0126370_11880986 | Not Available | 581 | Open in IMG/M |
| 3300010359|Ga0126376_12080012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300010361|Ga0126378_13259941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300010376|Ga0126381_100795404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1358 | Open in IMG/M |
| 3300012357|Ga0137384_10240413 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300012930|Ga0137407_11997863 | Not Available | 553 | Open in IMG/M |
| 3300014165|Ga0181523_10367788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 804 | Open in IMG/M |
| 3300014168|Ga0181534_10100284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1450 | Open in IMG/M |
| 3300014199|Ga0181535_10578887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300014201|Ga0181537_11136640 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300014489|Ga0182018_10383241 | Not Available | 754 | Open in IMG/M |
| 3300014495|Ga0182015_10781758 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300014501|Ga0182024_10077217 | All Organisms → cellular organisms → Bacteria | 4990 | Open in IMG/M |
| 3300014657|Ga0181522_10263008 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300015241|Ga0137418_11132182 | Not Available | 555 | Open in IMG/M |
| 3300015371|Ga0132258_10675532 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300017822|Ga0187802_10182245 | Not Available | 806 | Open in IMG/M |
| 3300017822|Ga0187802_10343159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300017931|Ga0187877_1362389 | Not Available | 549 | Open in IMG/M |
| 3300017972|Ga0187781_10156275 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300018030|Ga0187869_10440385 | Not Available | 620 | Open in IMG/M |
| 3300018034|Ga0187863_10635219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300018035|Ga0187875_10072226 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300018040|Ga0187862_10120496 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300018047|Ga0187859_10893528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300018062|Ga0187784_11166099 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300020580|Ga0210403_10214487 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300021170|Ga0210400_11375216 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300021403|Ga0210397_10194126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1447 | Open in IMG/M |
| 3300021420|Ga0210394_11645905 | Not Available | 539 | Open in IMG/M |
| 3300021560|Ga0126371_11211501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300021560|Ga0126371_12534680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300022732|Ga0224569_106530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300025414|Ga0208935_1043859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300026817|Ga0207775_109241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300027590|Ga0209116_1023127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300027619|Ga0209330_1015828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 1685 | Open in IMG/M |
| 3300027684|Ga0209626_1054488 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300027692|Ga0209530_1233663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300027829|Ga0209773_10064741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300027842|Ga0209580_10103141 | Not Available | 1380 | Open in IMG/M |
| 3300027853|Ga0209274_10292595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300027855|Ga0209693_10527840 | Not Available | 563 | Open in IMG/M |
| 3300027879|Ga0209169_10167730 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300027884|Ga0209275_10354521 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300027895|Ga0209624_10476761 | Not Available | 831 | Open in IMG/M |
| 3300028016|Ga0265354_1009670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300028572|Ga0302152_10039532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1475 | Open in IMG/M |
| 3300028747|Ga0302219_10258438 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300028806|Ga0302221_10048526 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300029701|Ga0222748_1128802 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300029910|Ga0311369_11164548 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300029914|Ga0311359_10355082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium dinghuense | 1180 | Open in IMG/M |
| 3300029914|Ga0311359_10439985 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300029943|Ga0311340_10155862 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300029951|Ga0311371_12129401 | Not Available | 589 | Open in IMG/M |
| 3300029999|Ga0311339_10050973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5557 | Open in IMG/M |
| 3300029999|Ga0311339_10076949 | All Organisms → cellular organisms → Bacteria | 4260 | Open in IMG/M |
| 3300029999|Ga0311339_11895284 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300030053|Ga0302177_10107121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1612 | Open in IMG/M |
| 3300030054|Ga0302182_10125020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1121 | Open in IMG/M |
| 3300030058|Ga0302179_10012034 | All Organisms → cellular organisms → Bacteria | 4433 | Open in IMG/M |
| 3300030518|Ga0302275_10644485 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300030617|Ga0311356_10845585 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031028|Ga0302180_10004718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 10072 | Open in IMG/M |
| 3300031258|Ga0302318_10184781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 996 | Open in IMG/M |
| 3300031753|Ga0307477_11134925 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae | 509 | Open in IMG/M |
| 3300031754|Ga0307475_10753618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300031942|Ga0310916_11237032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 616 | Open in IMG/M |
| 3300031962|Ga0307479_10056218 | All Organisms → cellular organisms → Bacteria | 3790 | Open in IMG/M |
| 3300032001|Ga0306922_11112973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300032783|Ga0335079_10539119 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300032895|Ga0335074_11189311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300034163|Ga0370515_0313527 | Not Available | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 12.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 10.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.85% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.94% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.97% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.97% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1049692652 | 3300000559 | Soil | ADPEFQALVKSEQVDRLVEKIDTTYMHSTDFSPMK* |
| AF_2010_repII_A001DRAFT_100844091 | 3300000793 | Forest Soil | LADPEVEEAIKSEEANKLVEKIDRMYMRSTDFSPMK* |
| JGI12635J15846_102254851 | 3300001593 | Forest Soil | EMRADPATQELLKSEQADKLLEKVDSTYMRSTDFSPMK* |
| JGIcombinedJ26739_1000115284 | 3300002245 | Forest Soil | MLALSGPDPEFQEVIKSEQTNKLVEKIDSTYMRPTGFSPLK* |
| Ga0062384_1006443931 | 3300004082 | Bog Forest Soil | WDAMFADPAFQEMMKSEQAGKLVDKVDVTYMRPTDFSAMK* |
| Ga0062388_1023980551 | 3300004635 | Bog Forest Soil | EEAKKNWDAMRADPATQEMLKSEQADKLVEKVDSTYMRPEDFSPMK* |
| Ga0070733_109316792 | 3300005541 | Surface Soil | EEAKKNWDAMRADPATQELLKSEQADKLLEKVDSTYMRPEDFSPMK* |
| Ga0070732_100257763 | 3300005542 | Surface Soil | ADPEVREAIKSEEANKLVEKIDRTYMRPTDFSPK* |
| Ga0070761_101312023 | 3300005591 | Soil | DPEFQEVIKSEQTNKLVEKIDSTYMRPTDYSPLK* |
| Ga0070761_108068491 | 3300005591 | Soil | AFRADPEFQEVLKAEQANKTVEKIDATYMRPTDFSPMK* |
| Ga0070763_105580371 | 3300005610 | Soil | WEAMFNDPGFAEIVKDEAAEKLVEGVDSTYMDPTDFSPMN* |
| Ga0070764_101981641 | 3300005712 | Soil | KKNWDAMMADPEFQDVIKAEQAEKLVEKVDVTYMRATDFSLIK* |
| Ga0070764_106695501 | 3300005712 | Soil | DPAFQEVLKSEQKERLLERADTTYMQPEDFSPMK* |
| Ga0066903_1074828081 | 3300005764 | Tropical Forest Soil | AMLADPEVQEAIKSEQANKLVEKIDRTYMRSTDFSPMK* |
| Ga0075030_1011653942 | 3300006162 | Watersheds | DPEVQEAIKSEQGANKLVEKINRTYMRSPDFSPMK* |
| Ga0070765_1013283861 | 3300006176 | Soil | EEEKKNWDAMVADPEFQQDVIKAEQTEKTVEKVDVSHMSPTDFSAIQ* |
| Ga0070765_1021304112 | 3300006176 | Soil | DPEFQEVIKSGPANKLVEQTDSTYMRPTDFSPLK* |
| Ga0099830_105169521 | 3300009088 | Vadose Zone Soil | DPAFQEMVKSEQTEKLIEKVDSTYMHPTDFSPMK* |
| Ga0116222_15220541 | 3300009521 | Peatlands Soil | MRADPATQEMLKSEEADKLLEKVDSTYMRPEDFSPMK* |
| Ga0116105_12353712 | 3300009624 | Peatland | ADPKTQEAIKAEEAEKRVEKVDVTYMRPTDFSPMK* |
| Ga0116106_12874591 | 3300009645 | Peatland | KKNWDAMRADPDFQELIRENSEQASKLVEKVDVLYMRPTDFSPMK* |
| Ga0116135_14543281 | 3300009665 | Peatland | NWDAMRADPDVQELIKSEQADKLVEKIDSTYMRPEDFSPMK* |
| Ga0116135_14592411 | 3300009665 | Peatland | DAMLADPEVQEAIKSEEANKLVEKIDRTYMRPEDFSPMK* |
| Ga0116216_106517081 | 3300009698 | Peatlands Soil | WDAMRADPGFQEMLKSEQTDKLVEKVDTTYMHPTDFSPMK* |
| Ga0116101_10048543 | 3300009759 | Peatland | WDAMRADPAVQEMIKSEKADNLVEKIDSTYMRPEDFSPMK* |
| Ga0116130_10805771 | 3300009762 | Peatland | KKNWDAMLPDPEVLEAIKSEEANKLVEKIDRMYMRSTDFSPMK* |
| Ga0126374_117646941 | 3300009792 | Tropical Forest Soil | KNWDAMLADPETQEAIKSEEASKPVEKIDRTYMRSTDFSPMK* |
| Ga0126373_114665953 | 3300010048 | Tropical Forest Soil | ADPEVQEAIKSEQANKLVEKIDRTYMRSTDFSPMK* |
| Ga0074044_104936893 | 3300010343 | Bog Forest Soil | DAMLADPEVQEAIKSEEANKLVEKIDRVYMRSTDFSPMK* |
| Ga0126370_118809862 | 3300010358 | Tropical Forest Soil | LADPEVQAAIKSEEADKLVEKIDRAYMRPTDFSPK* |
| Ga0126376_120800123 | 3300010359 | Tropical Forest Soil | DAMLADPEVQEAIKSEQANKLVEKIDRTYMPPTDFSPMK* |
| Ga0126378_132599411 | 3300010361 | Tropical Forest Soil | ADPEVQEAIKSEQTNKLVEKIDRTYMRSTDFSPLK* |
| Ga0126381_1007954044 | 3300010376 | Tropical Forest Soil | MLADPEVQEAIKSEEANKLVEKIDRTYMRSTDFSPMK* |
| Ga0137384_102404132 | 3300012357 | Vadose Zone Soil | MRADPVTQEMIKSEQADKLVEKIDSTYVRPEDFSPMK* |
| Ga0137407_119978631 | 3300012930 | Vadose Zone Soil | EEAKKNWDAMRADPDFQELIRKNSEPATKLVEKVDVTYMRPTDFSPMK* |
| Ga0181523_103677883 | 3300014165 | Bog | VADPEFQDVIKSEQANKLVEKEDSTYMHPADFSPMK* |
| Ga0181534_101002842 | 3300014168 | Bog | AKKNWDAMFADPGFAEVINSEKAEKTVESVDPTYMRPTDFSPAK* |
| Ga0181535_105788872 | 3300014199 | Bog | ADPATQELLKSEQADKLLEKVDSTYMRPTDFSPMK* |
| Ga0181537_111366402 | 3300014201 | Bog | EEAKKNWDGFRHDPAFQEEIKSEQANKLVEKIDSTYMSPTDFSPLK* |
| Ga0182018_103832413 | 3300014489 | Palsa | AEMFADPAFQSMMKEEQTDKLVQKVDDIYMHPSDFSATK* |
| Ga0182015_107817582 | 3300014495 | Palsa | MFADPDFQEMAKSEQANKLVEKVDATYMHPTDFSPMQ* |
| Ga0182024_100772173 | 3300014501 | Permafrost | MRADPDFQALIKENSEPASKLVEKVDVMYMRPTDFSPMK* |
| Ga0181522_102630082 | 3300014657 | Bog | MADPEFQEVLKSEQANKLVEKIDSTYMRPTDFSPIK* |
| Ga0137418_111321821 | 3300015241 | Vadose Zone Soil | AMLADPEVQEAIKSEQANKLVEKIDRTYMRSSDFSPMK* |
| Ga0132258_106755323 | 3300015371 | Arabidopsis Rhizosphere | DPEFQELIKAEQANKLTEKIDRTYMRPTDFSPMK* |
| Ga0187802_101822451 | 3300017822 | Freshwater Sediment | KKNWEAMHADPGFQKIVKSEQAEKLVEKVDSVYMHPTDFSLMK |
| Ga0187802_103431592 | 3300017822 | Freshwater Sediment | ADPEVQEAIKSEEANKLVEKIDRMYMRSTDFSPMK |
| Ga0187877_13623891 | 3300017931 | Peatland | WDAFGADPGFQEVVKAEQADRLVEKVDSTYMHPTDFSPMK |
| Ga0187781_101562754 | 3300017972 | Tropical Peatland | MMADPEFQGVIKAEQANKLVEKIDRTYMRPTDFSPMK |
| Ga0187869_104403851 | 3300018030 | Peatland | PNRQEAKEHWDAMRADPLFQEMLKSEQTEKRVENIEATYMHPTDFSPMK |
| Ga0187863_106352191 | 3300018034 | Peatland | KKNWDAMRTDPATQELLKSEQADKLLEKVDSTYMRPEDFSPMK |
| Ga0187875_100722263 | 3300018035 | Peatland | ADPEFQEMLRSEQTEKLVEKIDSTYMHPSDFSPLK |
| Ga0187862_101204961 | 3300018040 | Peatland | EEAKKNWDAMRADPATQELLKSEQADKLLEKVDSTYMRPEDFSPMK |
| Ga0187859_108935281 | 3300018047 | Peatland | KKNWDAMRADPATQELLKSEQADKLLEKVDSTYMRPEDFSPMK |
| Ga0187784_111660993 | 3300018062 | Tropical Peatland | ADPEVQEAIKSEQANKLVEKIDRTYMRSTDFSPMK |
| Ga0210403_102144872 | 3300020580 | Soil | ADPGFQEVLKTEQADKTVEKIDVTYMHPTDFSPMK |
| Ga0210400_113752161 | 3300021170 | Soil | GDRDAMRSDPEFQEIAKSEQADKLVEKVDVTYMHPTDFSPTK |
| Ga0210397_101941261 | 3300021403 | Soil | RADPDFQAMLKSEQTEKTVEKIDATYMRPTDFSPMK |
| Ga0210394_116459052 | 3300021420 | Soil | MRADPGFQEMLKSEQTEKTVEKIDSTYMRPTDFSRMK |
| Ga0126371_112115012 | 3300021560 | Tropical Forest Soil | FHADPRFQEYVKAEEAEKLIDKVDSTYMRPTDFSLTR |
| Ga0126371_125346802 | 3300021560 | Tropical Forest Soil | MLADPEVQEAIKSEQANKLVEKIDRTYMRSTDFSPMK |
| Ga0224569_1065301 | 3300022732 | Rhizosphere | RADPATQELLKSEQADKLLEKVDSTYMRPEDFSPMK |
| Ga0208935_10438592 | 3300025414 | Peatland | AKKNWDAMRADPATQELLKSEQADKLLEKVDSTYMRPEDFSPAK |
| Ga0207775_1092411 | 3300026817 | Tropical Forest Soil | EEAKKNWDAMLADAEVQEAIKSEEANKLVEKIDRTYMRSTDFSPMK |
| Ga0209116_10231272 | 3300027590 | Forest Soil | DAMRADPAFQEVLKAEQANKTVEKIDETYMRPTDFSPMK |
| Ga0209330_10158283 | 3300027619 | Forest Soil | MMADPEFQEVMKSEQANKLVEKIDSTYMRPTGFSPLK |
| Ga0209626_10544881 | 3300027684 | Forest Soil | MLADSEVREAIKSEETNKLVEKIDRTYMRPTDFSPK |
| Ga0209530_12336632 | 3300027692 | Forest Soil | EEMRADPATQELLKSEQADKLLEKVDSTYMRSTDFSPMK |
| Ga0209773_100647413 | 3300027829 | Bog Forest Soil | MGDPEFQEVLKSERATKLVEKIDSTYMRPTDFSPMK |
| Ga0209580_101031412 | 3300027842 | Surface Soil | KNWDAMRADSDFQELIRKNSEPASKLVEKVDVMYMRPTDFSPMK |
| Ga0209274_102925952 | 3300027853 | Soil | WDGMRADPEFQEVLKAEQANKTVEKIDETYMRPTDFSPMK |
| Ga0209693_105278402 | 3300027855 | Soil | WEAMFNDPGFAEIVKDEAAEKLVEGVDSTYMDPTDFSPMN |
| Ga0209169_101677302 | 3300027879 | Soil | GDAMMADPEFQDVIKAEQAEKLVEKVDVTYMRATDFSLIK |
| Ga0209275_103545212 | 3300027884 | Soil | ADPEFQNVIKDEQAEKLVEKVDVTYMRPTDFSMIK |
| Ga0209624_104767612 | 3300027895 | Forest Soil | MMADPEFQAVIKSEQVNKLVEKVDSTYMHPADFSPMK |
| Ga0265354_10096702 | 3300028016 | Rhizosphere | MRGDPATQELLKSEQADKLLEKVDSTYMRPEDFSPMK |
| Ga0302152_100395323 | 3300028572 | Bog | MRADPATQEMIKSEQADKLVEKIDSTYMRPEDFSPMK |
| Ga0302219_102584382 | 3300028747 | Palsa | FRTDPAFQEELKSEQANKLVEKVDSTYMRPTDFSPMK |
| Ga0302221_100485264 | 3300028806 | Palsa | WDAMEADPEFLEMVKSEQTVKLVQKVDSTFMLPTDFSPMK |
| Ga0222748_11288021 | 3300029701 | Soil | KNWDAMFADPAFQEMMKSEQADKLVEKVDVTYMHPMDFSQMK |
| Ga0311369_111645482 | 3300029910 | Palsa | MMADPEFQDVIKAEQAEKLVEKVDVTYMRATDFSLIK |
| Ga0311359_103550823 | 3300029914 | Bog | EAKKNWDAMRADPATQEMIKSEQADKLVEKIDTTYMRPEDFSPMK |
| Ga0311359_104399852 | 3300029914 | Bog | MRADPATQEMIKSERADKLVEKVDSTYMRPEDFSPMK |
| Ga0311340_101558621 | 3300029943 | Palsa | MLADPEFQEMMKLEQTEKLVEKVDSTYMHPADFSPMK |
| Ga0311371_121294011 | 3300029951 | Palsa | AMRADPAFQEALKSEQANKLVEKIDSTYMRPADFSPMK |
| Ga0311339_100509732 | 3300029999 | Palsa | MGSGQTPEFQELLKAKQANKTVEKIGETYMRPTDFSPMK |
| Ga0311339_100769493 | 3300029999 | Palsa | MLADPEFQEMMKLEQTEKLVEKVDSTYMHPADFSR |
| Ga0311339_118952841 | 3300029999 | Palsa | AMRADPATQEMIKSEQADKLVEKIDSTYMRPEDFSPMK |
| Ga0302177_101071211 | 3300030053 | Palsa | DAMLADPEVQEAIKSEEANKLVEKIDRMYMRSTDFSPMK |
| Ga0302182_101250203 | 3300030054 | Palsa | AKKNWDAMLADPEFQEMMKLEQTEKLVEKVDSTYMHPADFSR |
| Ga0302179_100120342 | 3300030058 | Palsa | MGSGQTPEFQEVLKAEQANKTVEKIGETYMRPTDFSPMK |
| Ga0302275_106444851 | 3300030518 | Bog | AMRADPATQEMIKSEQADKLVENIDSTYMRPADFSPMK |
| Ga0311356_108455851 | 3300030617 | Palsa | ADPDFQEVIRKNSDPATKLVEKVDVTYMRPTDFSPIK |
| Ga0302180_100047186 | 3300031028 | Palsa | GSGQTPEFQELLKAEQANKTVEKIGETYMRPTDFSPMK |
| Ga0302318_101847811 | 3300031258 | Bog | ADPATQEMIKSEQADKLVENIDSTYMRPADFSPMK |
| Ga0307477_111349251 | 3300031753 | Hardwood Forest Soil | ADPDFQELIRKNAEQANKLVEKVDVTYMRPTDFSPMK |
| Ga0307475_107536181 | 3300031754 | Hardwood Forest Soil | EAKKNWDAMRADPDFQELMRKNSEQASKLVEKVDVMYMRPTDFSPMK |
| Ga0310916_112370322 | 3300031942 | Soil | LADPEVQEAIKSEQANKLVEKIDRTYMRSTDFSPMK |
| Ga0307479_100562185 | 3300031962 | Hardwood Forest Soil | MRADPDFQELIRKNSEQASKLVEKVDVMYMRPTDFSPMK |
| Ga0306922_111129731 | 3300032001 | Soil | LADPEVQEAIKSEEANKLVEKIDRTYMRPTDFSPK |
| Ga0335079_105391193 | 3300032783 | Soil | LHADPGFQEIVKSEQAEKLVEKVDSVYRHPADFSPMK |
| Ga0335074_111893112 | 3300032895 | Soil | PDFQEIVRKNSDPATKLVDKIDVLYMRPTDFSPMK |
| Ga0370515_0313527_548_661 | 3300034163 | Untreated Peat Soil | ADPDFQALIKESSDPARKLVEKVDVMYMRPTDFSRMK |
| ⦗Top⦘ |