


| Basic Information | |
|---|---|
| Family ID | F099511 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 37 residues |
| Representative Sequence | DHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.91 % |
| % of genes near scaffold ends (potentially truncated) | 93.20 % |
| % of genes from short scaffolds (< 2000 bps) | 94.17 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.233 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.621 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.039 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.631 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.62% β-sheet: 0.00% Coil/Unstructured: 59.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF03807 | F420_oxidored | 35.92 |
| PF13577 | SnoaL_4 | 7.77 |
| PF13462 | Thioredoxin_4 | 4.85 |
| PF03358 | FMN_red | 3.88 |
| PF01361 | Tautomerase | 2.91 |
| PF00005 | ABC_tran | 2.91 |
| PF00248 | Aldo_ket_red | 2.91 |
| PF07690 | MFS_1 | 2.91 |
| PF00106 | adh_short | 0.97 |
| PF07729 | FCD | 0.97 |
| PF00756 | Esterase | 0.97 |
| PF00201 | UDPGT | 0.97 |
| PF00196 | GerE | 0.97 |
| PF13847 | Methyltransf_31 | 0.97 |
| PF14542 | Acetyltransf_CG | 0.97 |
| PF04075 | F420H2_quin_red | 0.97 |
| PF12680 | SnoaL_2 | 0.97 |
| PF00107 | ADH_zinc_N | 0.97 |
| PF05977 | MFS_3 | 0.97 |
| PF04542 | Sigma70_r2 | 0.97 |
| PF04261 | Dyp_perox | 0.97 |
| PF08922 | DUF1905 | 0.97 |
| PF01556 | DnaJ_C | 0.97 |
| PF02371 | Transposase_20 | 0.97 |
| PF01694 | Rhomboid | 0.97 |
| PF04203 | Sortase | 0.97 |
| PF03446 | NAD_binding_2 | 0.97 |
| PF07731 | Cu-oxidase_2 | 0.97 |
| PF12681 | Glyoxalase_2 | 0.97 |
| PF00753 | Lactamase_B | 0.97 |
| PF02148 | zf-UBP | 0.97 |
| PF13434 | Lys_Orn_oxgnase | 0.97 |
| PF00198 | 2-oxoacid_dh | 0.97 |
| PF07366 | SnoaL | 0.97 |
| PF00561 | Abhydrolase_1 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.91 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 1.94 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.97 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.97 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.97 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.97 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.97 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.97 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.23 % |
| Unclassified | root | N/A | 7.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10719481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1802 | Open in IMG/M |
| 3300001538|A10PFW1_11050244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
| 3300001867|JGI12627J18819_10291591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 657 | Open in IMG/M |
| 3300004081|Ga0063454_101250820 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300004114|Ga0062593_101191873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
| 3300005445|Ga0070708_101901806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300005447|Ga0066689_10680170 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005526|Ga0073909_10100682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1142 | Open in IMG/M |
| 3300005536|Ga0070697_100667731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
| 3300005543|Ga0070672_101528787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300005556|Ga0066707_11013931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300005563|Ga0068855_100185388 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300005586|Ga0066691_10723516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300005719|Ga0068861_101321612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300005841|Ga0068863_102479064 | Not Available | 528 | Open in IMG/M |
| 3300005842|Ga0068858_101608900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300005843|Ga0068860_102072596 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006196|Ga0075422_10474620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300006606|Ga0074062_10490423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 719 | Open in IMG/M |
| 3300006755|Ga0079222_11023082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 714 | Open in IMG/M |
| 3300006845|Ga0075421_102496483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 539 | Open in IMG/M |
| 3300006854|Ga0075425_100406608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1568 | Open in IMG/M |
| 3300006854|Ga0075425_103091014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 507 | Open in IMG/M |
| 3300006871|Ga0075434_102572885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300006880|Ga0075429_100287348 | Not Available | 1440 | Open in IMG/M |
| 3300006903|Ga0075426_11556912 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006904|Ga0075424_102125231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300006914|Ga0075436_100472850 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300007788|Ga0099795_10312580 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009011|Ga0105251_10338670 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009089|Ga0099828_11535559 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009094|Ga0111539_11671344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300009098|Ga0105245_10089048 | All Organisms → cellular organisms → Bacteria | 2836 | Open in IMG/M |
| 3300009098|Ga0105245_10564627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300009100|Ga0075418_11837858 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300009137|Ga0066709_101674600 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300009162|Ga0075423_11518477 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010323|Ga0134086_10423312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300010358|Ga0126370_10677943 | Not Available | 902 | Open in IMG/M |
| 3300010375|Ga0105239_12160154 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010376|Ga0126381_101038460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1183 | Open in IMG/M |
| 3300010401|Ga0134121_11772369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 643 | Open in IMG/M |
| 3300010403|Ga0134123_13012959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300011271|Ga0137393_11152222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300012003|Ga0120163_1095672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 655 | Open in IMG/M |
| 3300012199|Ga0137383_10375918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1041 | Open in IMG/M |
| 3300012349|Ga0137387_11012484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300012354|Ga0137366_10338612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
| 3300012356|Ga0137371_11454335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300012362|Ga0137361_10899521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
| 3300012532|Ga0137373_10520392 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300012927|Ga0137416_10123309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1987 | Open in IMG/M |
| 3300012927|Ga0137416_11524547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300012951|Ga0164300_10873065 | Not Available | 566 | Open in IMG/M |
| 3300012960|Ga0164301_10735499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300012961|Ga0164302_10124910 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300012987|Ga0164307_11253982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300013294|Ga0120150_1085963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300013297|Ga0157378_12820473 | Not Available | 538 | Open in IMG/M |
| 3300013763|Ga0120179_1068910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 794 | Open in IMG/M |
| 3300015373|Ga0132257_101687539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300016357|Ga0182032_11676020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300018053|Ga0184626_10083046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1354 | Open in IMG/M |
| 3300020020|Ga0193738_1036293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1518 | Open in IMG/M |
| 3300021073|Ga0210378_10191358 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300021078|Ga0210381_10012067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2123 | Open in IMG/M |
| 3300021180|Ga0210396_10308993 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300021363|Ga0193699_10317012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300022756|Ga0222622_10272920 | Not Available | 1154 | Open in IMG/M |
| 3300025134|Ga0207416_1027538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2762 | Open in IMG/M |
| 3300025911|Ga0207654_10380678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
| 3300025916|Ga0207663_10238879 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300025922|Ga0207646_10516483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1075 | Open in IMG/M |
| 3300025939|Ga0207665_11260622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TML/M2B | 589 | Open in IMG/M |
| 3300025940|Ga0207691_10258163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1502 | Open in IMG/M |
| 3300025942|Ga0207689_10327650 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300025945|Ga0207679_10369713 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300026089|Ga0207648_12109901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300027465|Ga0207626_103087 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 599 | Open in IMG/M |
| 3300027565|Ga0209219_1024167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300027821|Ga0209811_10034619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
| 3300027873|Ga0209814_10528252 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028047|Ga0209526_10361819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300028047|Ga0209526_10893417 | Not Available | 541 | Open in IMG/M |
| 3300028536|Ga0137415_10074951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3243 | Open in IMG/M |
| 3300028782|Ga0307306_10138018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300028784|Ga0307282_10389829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300028811|Ga0307292_10315771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300028828|Ga0307312_10030349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3145 | Open in IMG/M |
| 3300028828|Ga0307312_10462086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 836 | Open in IMG/M |
| 3300028828|Ga0307312_10558872 | Not Available | 756 | Open in IMG/M |
| 3300031680|Ga0318574_10960084 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031720|Ga0307469_10334139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1265 | Open in IMG/M |
| 3300031744|Ga0306918_11229098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300031910|Ga0306923_11355047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300031946|Ga0310910_10855291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 715 | Open in IMG/M |
| 3300031962|Ga0307479_10267300 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300032064|Ga0318510_10425284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 568 | Open in IMG/M |
| 3300032174|Ga0307470_10576767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 836 | Open in IMG/M |
| 3300032180|Ga0307471_100724670 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300032180|Ga0307471_102097877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 710 | Open in IMG/M |
| 3300034817|Ga0373948_0200870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300034817|Ga0373948_0222989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.85% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027465 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_107194811 | 3300000550 | Soil | GFDHLPTDDEVAEVSDRWRPYRSLAVSYLFASEYDGQP* |
| A10PFW1_110502442 | 3300001538 | Permafrost | YGFDDRPTEAEVAEVSDRWRPYRSLAVSYLFASEYQERT* |
| JGI12627J18819_102915911 | 3300001867 | Forest Soil | LPTEDEMIRLAERWRPYRSLAVSYLFASEFEKGT* |
| Ga0063454_1012508202 | 3300004081 | Soil | YGFEHIPTQAQLTQISDRWRPDRSLAVSYLFASEYEGKQAPTS* |
| Ga0062593_1011918732 | 3300004114 | Soil | MALDHVPTEDELTQLPKRWRPYRSLAVSYLFASEYDGGP* |
| Ga0070708_1019018061 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AFDHLPTDEEMVQIADRWRPFRSLAVSYLFASEFGAGTTATVRRPR* |
| Ga0066689_106801701 | 3300005447 | Soil | MTIDHRPTEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP* |
| Ga0073909_101006823 | 3300005526 | Surface Soil | HLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQE* |
| Ga0070697_1006677311 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FDHLPTDEELVELSDRWRPYRSLAVSYLFASAYDEQPPV* |
| Ga0070672_1015287872 | 3300005543 | Miscanthus Rhizosphere | DHLPTDDEVAEVSDRWRPYRSLGVSYLFASEYDAQP* |
| Ga0066707_110139311 | 3300005556 | Soil | HLPNDDDLAQVSARWRPYRSLAVSYLFASEYDGQP* |
| Ga0068855_1001853881 | 3300005563 | Corn Rhizosphere | LDHLPTEREMVEFAERWRPYRSLAVSYLFASEFEEGT* |
| Ga0066691_107235162 | 3300005586 | Soil | HLPTEDEMGLLADRWRPYRSLAVSYLFASEYDGGST* |
| Ga0068861_1013216121 | 3300005719 | Switchgrass Rhizosphere | VGFDHPPTDDEVAQISDRWRPYRSLAVSYLFASEYDGQP |
| Ga0068863_1024790642 | 3300005841 | Switchgrass Rhizosphere | HVPTEDEMTQLAERRRPYRSLAVSYLFASEYDERT* |
| Ga0068858_1016089001 | 3300005842 | Switchgrass Rhizosphere | AIQRTYGIDHVPTEDEMKQLSDRWRPFRSLAASYLFASEYDGQP* |
| Ga0068860_1020725961 | 3300005843 | Switchgrass Rhizosphere | HSPTEDEMLELAEHWRPYRSLAVSYLFASEYDGGI* |
| Ga0075422_104746202 | 3300006196 | Populus Rhizosphere | LPIDDEVVQVSDRWRPYRSLAVSYLFASEYDGQP* |
| Ga0074062_104904231 | 3300006606 | Soil | VPSDEEMERLAERWRPYRSLAVSYLFASEYDGGP* |
| Ga0079222_110230821 | 3300006755 | Agricultural Soil | VPSEAELVEISDRWRPYRSLAVSYLFASEYEGPR* |
| Ga0075421_1024964831 | 3300006845 | Populus Rhizosphere | LDHPPTEDEMLELAERWRPYRSLAVSYLFASEYDGGI* |
| Ga0075425_1004066081 | 3300006854 | Populus Rhizosphere | GFDHVPSEAELVEISDRWRPYRSLAVSYLFASEYEDAR* |
| Ga0075425_1030910141 | 3300006854 | Populus Rhizosphere | PTDDELIELSDRWRPYRSLAVSYLFASAYSGQPPT* |
| Ga0075434_1025728851 | 3300006871 | Populus Rhizosphere | AYGFDHVPTEEELMEIADRWRPYRSLAVSYLFAAEYEDGP* |
| Ga0075429_1002873484 | 3300006880 | Populus Rhizosphere | DHLPTEEEMVQLAERWRPYRSLAVSYLFASEYDGGT* |
| Ga0075426_115569121 | 3300006903 | Populus Rhizosphere | GFDHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDAQA* |
| Ga0075424_1021252312 | 3300006904 | Populus Rhizosphere | HVPSEDELTEITDRWRPYRSLAVSYLFASEYDGGA* |
| Ga0075436_1004728502 | 3300006914 | Populus Rhizosphere | FDHSPTDAEMLELAERWRPYRSLAVSYLFASEYEAPSTT* |
| Ga0099795_103125802 | 3300007788 | Vadose Zone Soil | GHLPAEREMAELAERWRPYRSLAVSYLFASEFEEGT* |
| Ga0105251_103386701 | 3300009011 | Switchgrass Rhizosphere | LDHLPTEREMLDIAERWRPYRSLAVAYLFTSEFEESH* |
| Ga0099828_115355592 | 3300009089 | Vadose Zone Soil | LPTEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP* |
| Ga0111539_116713441 | 3300009094 | Populus Rhizosphere | HLPTEDEVAQVSDRWRPYRSLAVSYLFATEYQDAT* |
| Ga0105245_100890481 | 3300009098 | Miscanthus Rhizosphere | GFDHVPTPDELIELSDRWRPYRSLAVSYVFASEYAG* |
| Ga0105245_105646271 | 3300009098 | Miscanthus Rhizosphere | DHLPTDDEVAQLSDRWRPYRSLAVSYLFASEYDGQT* |
| Ga0075418_118378581 | 3300009100 | Populus Rhizosphere | FDHVPSEAEIAEVADRWRPYRSLAVSYLFASEYEGTG* |
| Ga0066709_1016746002 | 3300009137 | Grasslands Soil | MTIDHRPTEDEVAQVSDRWPPYRSLAVSYLFASEYDGQP* |
| Ga0075423_115184772 | 3300009162 | Populus Rhizosphere | DHLPRAQEMLRIAEPWRPYRSLAVSYLFAYELERSVT* |
| Ga0134086_104233122 | 3300010323 | Grasslands Soil | LPDEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP* |
| Ga0126370_106779434 | 3300010358 | Tropical Forest Soil | GFDHLPTDAEVAEVSDRWRPYRSLAVSYLFASEYDGPRKEET* |
| Ga0105239_121601541 | 3300010375 | Corn Rhizosphere | FDRVPTPDQLIELSDRWRPYRSLAVSYVFASEYAG* |
| Ga0126381_1010384602 | 3300010376 | Tropical Forest Soil | EQQMLQIAEPWRPYRSLAVMYLFASEYDAQSAQS* |
| Ga0134121_117723691 | 3300010401 | Terrestrial Soil | DHMPNEDEMAEIADRWRPYRSLAVSYLFASEFEEGP* |
| Ga0134123_130129592 | 3300010403 | Terrestrial Soil | GFDHRPTDAEMLELAERWRPYRSLAVSYLFASEYEAPSTT* |
| Ga0137393_111522221 | 3300011271 | Vadose Zone Soil | RLDHVPSKAELVEISDRWRPYRSLAVSYLFSSEYEDPR* |
| Ga0120163_10956722 | 3300012003 | Permafrost | DEMLQLAERWRPYRSLAVSYLFASEFDEPASPQS* |
| Ga0137383_103759181 | 3300012199 | Vadose Zone Soil | GFDHVPTEGEMTQLAERWRPYRSLAVSYLFASEYDGQP* |
| Ga0137387_110124841 | 3300012349 | Vadose Zone Soil | HLPTEDEMGLLADRWRPYRSLAVSYLFASEYDGGPT* |
| Ga0137366_103386121 | 3300012354 | Vadose Zone Soil | RVYGFDHVPTEAELSELSDRWRPYRSLAVSYLFASQYNG* |
| Ga0137371_114543352 | 3300012356 | Vadose Zone Soil | GFDHLPTEDEMGLLADRWRPYRSLAVSYLFASEYDGGST* |
| Ga0137361_108995211 | 3300012362 | Vadose Zone Soil | GFDHLPTDEEVAQVSDRWRPYRSLAVSYLFASEYDGQP* |
| Ga0137373_105203921 | 3300012532 | Vadose Zone Soil | LPTEDEVAQVSDRWRPYRSLAVSYLFASEYEGQP* |
| Ga0137416_101233094 | 3300012927 | Vadose Zone Soil | MASRAIQHAYRFDHLPTEDEMVQVAERWRPHRSLVVSYLFASEFEKGT* |
| Ga0137416_115245472 | 3300012927 | Vadose Zone Soil | DHPPTEDEMVQLAEQWRPYRSLAVSYLFASEYDGGI* |
| Ga0164300_108730651 | 3300012951 | Soil | LDHHPTEREMVELAGRWRPCRSLAVSYLFASEFEEGT* |
| Ga0164301_107354992 | 3300012960 | Soil | GFDHLPTGDEVAQVSDRWRPYRRLAVSYLFASEYDGGT* |
| Ga0164302_101249101 | 3300012961 | Soil | HLPTEDEMVQVAERWRPYRSLAVDYLFASEYEKGT* |
| Ga0164307_112539821 | 3300012987 | Soil | QLPTEDEVTEVSDRWRPYRSLAVSYLFASEYEGAT* |
| Ga0120150_10859631 | 3300013294 | Permafrost | LPTDDEVVELAERWRPYRSLAVSYLFASEFEEAR* |
| Ga0157378_128204731 | 3300013297 | Miscanthus Rhizosphere | LPTEDEVAEVSDRWRPYRSLAVSYLFASEYDALP* |
| Ga0120179_10689101 | 3300013763 | Permafrost | ELPTVAGMLQLAERWRPYRSLAVSYLFASEYRGQT* |
| Ga0132257_1016875391 | 3300015373 | Arabidopsis Rhizosphere | KRSTDSEVPQVSDCWRPYRSLAVSYLFASEYDGQA* |
| Ga0182032_116760203 | 3300016357 | Soil | FDHLPTEEEMVQLAERWQPYRTLAVSYLFASAYEKVT |
| Ga0184626_100830461 | 3300018053 | Groundwater Sediment | DDEMLQLAERWRPYRSLAVSYLFAIEYDEPTSAQA |
| Ga0193738_10362931 | 3300020020 | Soil | DHLPTEDEMVEVAVRWRPYRSLAVSYLFASEYDEGR |
| Ga0210378_101913582 | 3300021073 | Groundwater Sediment | YVPSEEELIQVSDRWRPYRSLAVSYLFASEYDEGP |
| Ga0210381_100120671 | 3300021078 | Groundwater Sediment | HVPTEDEMTQLSERWRPYRSLAVSYLFASEYDRQP |
| Ga0210396_103089931 | 3300021180 | Soil | YGLDHTPTDEELAELSDRWRPYRSLAVSYLFASEYDV |
| Ga0193699_103170122 | 3300021363 | Soil | GLDDLPTEGEMVEIAERWRPYRSLAVSYLFASEFEERR |
| Ga0222622_102729201 | 3300022756 | Groundwater Sediment | HLPNEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP |
| Ga0207416_10275385 | 3300025134 | Iron-Sulfur Acid Spring | LPTDEELVELSDRWRPYRSLAVGYLFAPAYGGQPPA |
| Ga0207654_103806781 | 3300025911 | Corn Rhizosphere | GFDHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYQDAT |
| Ga0207663_102388791 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FDHLPTEAEVAEVSDRWRPYRSLAVSYLFASEYQERP |
| Ga0207646_105164832 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HLPTDDEMLQLAERWRPYRSLAVSYLFASEYDEPTSAQA |
| Ga0207665_112606222 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRSTASELIELSDRWPPYRSLAVSYIFASEYAG |
| Ga0207691_102581633 | 3300025940 | Miscanthus Rhizosphere | DHLPTDDEVAEVSDRWRPYRSLGVSYLFASEYDAQP |
| Ga0207689_103276501 | 3300025942 | Miscanthus Rhizosphere | YGFDHVPTESELIELSDRWRPYRSRAVSYLFASEYAA |
| Ga0207679_103697131 | 3300025945 | Corn Rhizosphere | GFDRVPTPDELIELSDRWRPYRSLAVSYVFASEYAG |
| Ga0207648_121099011 | 3300026089 | Miscanthus Rhizosphere | ELDHLPTEGEMLDIAERWRPYRSLAVAYLFTSEFEESH |
| Ga0207626_1030871 | 3300027465 | Soil | GFDHVPTEEELTEIADRWRPYRSLAVSYLFASEYDEGP |
| Ga0209219_10241671 | 3300027565 | Forest Soil | HLSTEDEMVQVAERWRPYRSLAVSYLFASEFEKGT |
| Ga0209811_100346193 | 3300027821 | Surface Soil | HLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQE |
| Ga0209814_105282521 | 3300027873 | Populus Rhizosphere | YDFDHLPNEDEVALVSDRWRPYRSLAVGYLFASEYESNRD |
| Ga0209526_103618192 | 3300028047 | Forest Soil | DHLPTEDEVAQVSDRWRPYRSLAVSYLFASEYDAQP |
| Ga0209526_108934172 | 3300028047 | Forest Soil | HLPTGDEMVQIAERWRPYRSLAVSYLFASEFEKGT |
| Ga0137415_100749516 | 3300028536 | Vadose Zone Soil | MASRAIQHAYRFDHLPTEDEMVQVAERWRPHRSLVVSYLFASEFEKGT |
| Ga0307306_101380182 | 3300028782 | Soil | FDHPPTEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP |
| Ga0307282_103898292 | 3300028784 | Soil | HLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP |
| Ga0307292_103157711 | 3300028811 | Soil | GHVPTEDEMTQLSERWRPYRSLAVSYLFASEYDGQP |
| Ga0307312_100303496 | 3300028828 | Soil | GFDHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP |
| Ga0307312_104620861 | 3300028828 | Soil | GFDHLPTDDEVAQVSDRWRPYRSLAVSYLFSSEYDGQP |
| Ga0307312_105588721 | 3300028828 | Soil | LRPRPVPTEPEVLQLAERWRPYRSLAVSYLFASEFET |
| Ga0318574_109600841 | 3300031680 | Soil | HVPTEEEIVEISDRWRPYRSLAVSYLFASEYDGGTG |
| Ga0307469_103341391 | 3300031720 | Hardwood Forest Soil | GFDHLPTDDEVAEVSDRWRPYRSLAVSYLFASEYEDPR |
| Ga0306918_112290982 | 3300031744 | Soil | VQRAYGLNRPPTDEGMAQISNRWRPYRSLAVSYLFASEYGV |
| Ga0306923_113550471 | 3300031910 | Soil | LTGDIALRRAIRRVYGFDHVPTEHELIELSDRWRLVSYLFASEYGG |
| Ga0310910_108552911 | 3300031946 | Soil | HLPTEDEMVQLAERWRPYRSLAVSYLFASEYEKGT |
| Ga0307479_102673003 | 3300031962 | Hardwood Forest Soil | DHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP |
| Ga0318510_104252841 | 3300032064 | Soil | SFDHVPTEEEIVEISDRWRPYRSLAVSYLFASEYDGGTG |
| Ga0307470_105767672 | 3300032174 | Hardwood Forest Soil | IQRAYGFDHLPTEDEVARVSDRWRPHRSLAVSYLFASEYDGQP |
| Ga0307471_1007246703 | 3300032180 | Hardwood Forest Soil | GFGQLPSEAEMVGLAERWRPYRSLAVSYLFASEYEGQT |
| Ga0307471_1020978771 | 3300032180 | Hardwood Forest Soil | FDHVPSEAELVKISDRWRPYRSLAVSYLFASEYEDPR |
| Ga0373948_0200870_410_520 | 3300034817 | Rhizosphere Soil | DHPPTEDEMLELAERWRPYRSLAVSYLFASEYDGQP |
| Ga0373948_0222989_2_115 | 3300034817 | Rhizosphere Soil | YGFDYLPTEEEVAEVSDRWRPYRSLAVSYLFASEYDA |
| ⦗Top⦘ |