


| Basic Information | |
|---|---|
| Family ID | F099400 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.84 % |
| % of genes near scaffold ends (potentially truncated) | 31.07 % |
| % of genes from short scaffolds (< 2000 bps) | 80.58 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.252 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil (19.417 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.039 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.456 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.67% β-sheet: 0.00% Coil/Unstructured: 49.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF13676 | TIR_2 | 9.71 |
| PF12071 | DUF3551 | 8.74 |
| PF04964 | Flp_Fap | 6.80 |
| PF04392 | ABC_sub_bind | 6.80 |
| PF00089 | Trypsin | 3.88 |
| PF07585 | BBP7 | 3.88 |
| PF01717 | Meth_synt_2 | 2.91 |
| PF03992 | ABM | 1.94 |
| PF01575 | MaoC_dehydratas | 0.97 |
| PF09939 | DUF2171 | 0.97 |
| PF01546 | Peptidase_M20 | 0.97 |
| PF05050 | Methyltransf_21 | 0.97 |
| PF13452 | MaoC_dehydrat_N | 0.97 |
| PF14023 | DUF4239 | 0.97 |
| PF00999 | Na_H_Exchanger | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 6.80 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 6.80 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.91 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.97 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.97 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.97 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.97 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.25 % |
| Unclassified | root | N/A | 41.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01B390O | Not Available | 561 | Open in IMG/M |
| 2228664021|ICCgaii200_c0863380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1495 | Open in IMG/M |
| 3300000156|NODE_c0376811 | Not Available | 715 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105443375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1441 | Open in IMG/M |
| 3300000787|JGI11643J11755_11651895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1095 | Open in IMG/M |
| 3300003911|JGI25405J52794_10143987 | Not Available | 542 | Open in IMG/M |
| 3300004114|Ga0062593_100435326 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300004114|Ga0062593_101234751 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300004114|Ga0062593_101447939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 737 | Open in IMG/M |
| 3300004156|Ga0062589_100000503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8997 | Open in IMG/M |
| 3300004156|Ga0062589_101975597 | Not Available | 591 | Open in IMG/M |
| 3300004157|Ga0062590_100462345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1066 | Open in IMG/M |
| 3300004479|Ga0062595_100761342 | Not Available | 790 | Open in IMG/M |
| 3300004479|Ga0062595_101836217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300004479|Ga0062595_102437540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 520 | Open in IMG/M |
| 3300004480|Ga0062592_100260250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1280 | Open in IMG/M |
| 3300004480|Ga0062592_100657743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 903 | Open in IMG/M |
| 3300004643|Ga0062591_102084606 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005162|Ga0066814_10004313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1459 | Open in IMG/M |
| 3300005164|Ga0066815_10014474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 1026 | Open in IMG/M |
| 3300005295|Ga0065707_10090502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4107 | Open in IMG/M |
| 3300005329|Ga0070683_101561012 | Not Available | 635 | Open in IMG/M |
| 3300005332|Ga0066388_108030230 | Not Available | 527 | Open in IMG/M |
| 3300005336|Ga0070680_100556501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 983 | Open in IMG/M |
| 3300005339|Ga0070660_101250248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 630 | Open in IMG/M |
| 3300005353|Ga0070669_100054600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2926 | Open in IMG/M |
| 3300005367|Ga0070667_100063040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3141 | Open in IMG/M |
| 3300005406|Ga0070703_10005498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3546 | Open in IMG/M |
| 3300005530|Ga0070679_101916533 | Not Available | 541 | Open in IMG/M |
| 3300005713|Ga0066905_100170966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1591 | Open in IMG/M |
| 3300005713|Ga0066905_100986071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 742 | Open in IMG/M |
| 3300005764|Ga0066903_100718778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1766 | Open in IMG/M |
| 3300006353|Ga0075370_10068287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2030 | Open in IMG/M |
| 3300006605|Ga0074057_12143706 | Not Available | 850 | Open in IMG/M |
| 3300006806|Ga0079220_10809044 | Not Available | 710 | Open in IMG/M |
| 3300006806|Ga0079220_11153230 | Not Available | 634 | Open in IMG/M |
| 3300006852|Ga0075433_10373456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1259 | Open in IMG/M |
| 3300006954|Ga0079219_11381034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 627 | Open in IMG/M |
| 3300007076|Ga0075435_102044619 | Not Available | 503 | Open in IMG/M |
| 3300009092|Ga0105250_10529856 | Not Available | 538 | Open in IMG/M |
| 3300009094|Ga0111539_10026368 | All Organisms → cellular organisms → Bacteria | 7106 | Open in IMG/M |
| 3300009101|Ga0105247_10073698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2140 | Open in IMG/M |
| 3300009147|Ga0114129_13383174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 513 | Open in IMG/M |
| 3300010359|Ga0126376_12943169 | Not Available | 526 | Open in IMG/M |
| 3300010362|Ga0126377_10037813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4131 | Open in IMG/M |
| 3300010362|Ga0126377_10542829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1200 | Open in IMG/M |
| 3300010371|Ga0134125_10097364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3275 | Open in IMG/M |
| 3300010371|Ga0134125_11134078 | Not Available | 855 | Open in IMG/M |
| 3300010373|Ga0134128_11878140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
| 3300010375|Ga0105239_12604517 | Not Available | 590 | Open in IMG/M |
| 3300010399|Ga0134127_10436910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1304 | Open in IMG/M |
| 3300010399|Ga0134127_10726996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 1035 | Open in IMG/M |
| 3300010401|Ga0134121_12710785 | Not Available | 541 | Open in IMG/M |
| 3300012496|Ga0157353_1040002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 535 | Open in IMG/M |
| 3300012515|Ga0157338_1003649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 1289 | Open in IMG/M |
| 3300012891|Ga0157305_10247881 | Not Available | 534 | Open in IMG/M |
| 3300012943|Ga0164241_10717695 | Not Available | 726 | Open in IMG/M |
| 3300012986|Ga0164304_11569031 | Not Available | 547 | Open in IMG/M |
| 3300014497|Ga0182008_10028754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2811 | Open in IMG/M |
| 3300015371|Ga0132258_10482218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3097 | Open in IMG/M |
| 3300015371|Ga0132258_11086635 | Not Available | 2022 | Open in IMG/M |
| 3300015372|Ga0132256_100644061 | Not Available | 1175 | Open in IMG/M |
| 3300015372|Ga0132256_101793788 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300015373|Ga0132257_101123681 | Not Available | 992 | Open in IMG/M |
| 3300015373|Ga0132257_102062849 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300015374|Ga0132255_100539460 | Not Available | 1718 | Open in IMG/M |
| 3300015374|Ga0132255_103335626 | Not Available | 684 | Open in IMG/M |
| 3300019356|Ga0173481_10001207 | All Organisms → cellular organisms → Bacteria | 6141 | Open in IMG/M |
| 3300019356|Ga0173481_10003010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4325 | Open in IMG/M |
| 3300022737|Ga0247747_1034582 | Not Available | 598 | Open in IMG/M |
| 3300022880|Ga0247792_1025273 | Not Available | 1012 | Open in IMG/M |
| 3300023073|Ga0247744_1077859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 572 | Open in IMG/M |
| 3300025900|Ga0207710_10425891 | Not Available | 683 | Open in IMG/M |
| 3300025907|Ga0207645_10555700 | Not Available | 779 | Open in IMG/M |
| 3300025917|Ga0207660_10320761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1237 | Open in IMG/M |
| 3300025917|Ga0207660_10582553 | Not Available | 911 | Open in IMG/M |
| 3300025921|Ga0207652_11628125 | Not Available | 550 | Open in IMG/M |
| 3300025941|Ga0207711_10048879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3619 | Open in IMG/M |
| 3300025941|Ga0207711_11670679 | Not Available | 580 | Open in IMG/M |
| 3300026035|Ga0207703_10072075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2855 | Open in IMG/M |
| 3300026758|Ga0207559_102225 | Not Available | 728 | Open in IMG/M |
| 3300026759|Ga0207527_100727 | Not Available | 979 | Open in IMG/M |
| 3300026764|Ga0207470_100048 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300027122|Ga0207538_1003979 | Not Available | 790 | Open in IMG/M |
| 3300027400|Ga0207560_106382 | Not Available | 514 | Open in IMG/M |
| 3300027425|Ga0207522_100597 | Not Available | 937 | Open in IMG/M |
| 3300027447|Ga0207622_100145 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300027560|Ga0207981_1016917 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300027765|Ga0209073_10470011 | Not Available | 526 | Open in IMG/M |
| 3300027876|Ga0209974_10100952 | Not Available | 1008 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1012403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1719 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1058820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 812 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10133900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 676 | Open in IMG/M |
| 3300031716|Ga0310813_10012406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5555 | Open in IMG/M |
| 3300031716|Ga0310813_11918048 | Not Available | 558 | Open in IMG/M |
| 3300031820|Ga0307473_10937071 | Not Available | 628 | Open in IMG/M |
| 3300032000|Ga0310903_10145462 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300032013|Ga0310906_10967345 | Not Available | 610 | Open in IMG/M |
| 3300032179|Ga0310889_10101671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283 | 1224 | Open in IMG/M |
| 3300032180|Ga0307471_100639749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1225 | Open in IMG/M |
| 3300033475|Ga0310811_10007559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13944 | Open in IMG/M |
| 3300034692|Ga0373917_0005777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1373 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 19.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.91% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.97% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.97% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026751 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026758 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026759 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026764 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027122 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027400 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027425 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027447 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G08K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034692 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_01299870 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MRKLTWIIGLLALGASLDSSLYDGAYTRALVNAIQDMHTAIGLK |
| ICCgaii200_08633803 | 2228664021 | Soil | MRKFTWIIGLLALGAALDSSLYDGAYTRAFVYMIQDAHRSIGLK |
| NODE_03768113 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLR* |
| INPhiseqgaiiFebDRAFT_1054433751 | 3300000364 | Soil | MRMAVWIVGLLALATSLDTSLYDGAYTRAFVGMIRDLYAAIGLNRIG* |
| JGI11643J11755_116518953 | 3300000787 | Soil | MRKFTWIIGLLALGAALDSSLYDGAYTRAFVYMIQDAHRSIGLK* |
| JGI25405J52794_101439871 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIRDLYAAIGLNRIG* |
| Ga0062593_1004353262 | 3300004114 | Soil | MRMLTWIVGLLALGASLDSSLWDGAYTRAFVTMIHDLHTAIGLNLTR* |
| Ga0062593_1012347512 | 3300004114 | Soil | MRMLTWIIGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG* |
| Ga0062593_1014479393 | 3300004114 | Soil | LAPMRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLR* |
| Ga0062589_1000005032 | 3300004156 | Soil | MRMLIWIVGLLALGASLDSSLYDGAYTRALVGKIQDTHTAIGLK* |
| Ga0062589_1019755971 | 3300004156 | Soil | AMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG* |
| Ga0062590_1004623451 | 3300004157 | Soil | MLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG* |
| Ga0062595_1007613422 | 3300004479 | Soil | MRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG* |
| Ga0062595_1018362171 | 3300004479 | Soil | MRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKLTG* |
| Ga0062595_1024375401 | 3300004479 | Soil | IWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0062592_1002602504 | 3300004480 | Soil | MRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLR* |
| Ga0062592_1006577431 | 3300004480 | Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0062591_1020846062 | 3300004643 | Soil | WIIGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG* |
| Ga0066814_100043132 | 3300005162 | Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKTFGLNLPG* |
| Ga0066815_100144741 | 3300005164 | Soil | KNCSASLLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0065707_100905024 | 3300005295 | Switchgrass Rhizosphere | MLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0070683_1015610122 | 3300005329 | Corn Rhizosphere | LSGIIVAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG* |
| Ga0066388_1080302302 | 3300005332 | Tropical Forest Soil | MRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIGNLYTAIGLNRIG* |
| Ga0070680_1005565013 | 3300005336 | Corn Rhizosphere | MRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLK* |
| Ga0070660_1012502482 | 3300005339 | Corn Rhizosphere | MRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGFK* |
| Ga0070669_1000546004 | 3300005353 | Switchgrass Rhizosphere | LLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0070667_1000630404 | 3300005367 | Switchgrass Rhizosphere | MRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG* |
| Ga0070703_100054984 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLMRMLIWIVGLLALATPLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0070679_1019165332 | 3300005530 | Corn Rhizosphere | MRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLK* |
| Ga0066905_1001709662 | 3300005713 | Tropical Forest Soil | MRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIGSLYTAIGLNRIG* |
| Ga0066905_1009860711 | 3300005713 | Tropical Forest Soil | MRKAVWIVGLLALATSLDTSLYDGAYTRAFVGMIGSLYTAIGLNRIG* |
| Ga0066903_1007187783 | 3300005764 | Tropical Forest Soil | MRMAVWIVGLLALASTLDTSLNDGAYTRALAGMIQDLYAALGLNRIG* |
| Ga0075370_100682875 | 3300006353 | Populus Endosphere | AAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG* |
| Ga0074057_121437062 | 3300006605 | Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKTFGLNLPG |
| Ga0079220_108090441 | 3300006806 | Agricultural Soil | MRPLIWIIGLLALATSLDSSLNDGIYTRAFVGMIQDLNAAFGLNRIG* |
| Ga0079220_111532302 | 3300006806 | Agricultural Soil | MRMAVWIVGLLALATSLDSSLNGGEYTRAFVSMIQDIPSSIGLQRIS* |
| Ga0075433_103734562 | 3300006852 | Populus Rhizosphere | MRMAVWIIGLLALATSLDSSLNDGIYTRAFVSMIQDLHTALGLNRIG* |
| Ga0079219_113810341 | 3300006954 | Agricultural Soil | TIEAHLCAMRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLR* |
| Ga0075435_1020446192 | 3300007076 | Populus Rhizosphere | MRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQD |
| Ga0105250_105298561 | 3300009092 | Switchgrass Rhizosphere | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLN |
| Ga0111539_100263687 | 3300009094 | Populus Rhizosphere | MRMLVWIVGLLALATSLDASLNDGIYTRAFVSMIQDFPATVGLNRIG* |
| Ga0105247_100736984 | 3300009101 | Switchgrass Rhizosphere | LSGIIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG* |
| Ga0114129_133831741 | 3300009147 | Populus Rhizosphere | MRMLVWIVGLLALATSLDASLNDGIYTRAFVSMIQD |
| Ga0126376_129431692 | 3300010359 | Tropical Forest Soil | MAVWIVGLLALASTLDTSLNDGAYTRALAGMIQDLYAALGLNRIG* |
| Ga0126377_100378133 | 3300010362 | Tropical Forest Soil | MRMAVWIVGLLALASTLDTSLNDGAYTRALVGMIQDLHTALGLNRIG* |
| Ga0126377_105428292 | 3300010362 | Tropical Forest Soil | MRMAVWIVGLLALATSLDTSLYDGAYTRAFVGMIADLYIALGLNRIG* |
| Ga0134125_100973644 | 3300010371 | Terrestrial Soil | MFIWIVGLLALATSLDSSLNDGAYTRAFVGLIQDLNAAFGLNRIG* |
| Ga0134125_111340782 | 3300010371 | Terrestrial Soil | MRILIWIVGLLALGTSLDSSLYGGAYTRAFVTSIQDMHRAFGLHLFG* |
| Ga0134128_118781403 | 3300010373 | Terrestrial Soil | FTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLK* |
| Ga0105239_126045171 | 3300010375 | Corn Rhizosphere | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAF |
| Ga0134127_104369103 | 3300010399 | Terrestrial Soil | LSGILAPMRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLK* |
| Ga0134127_107269962 | 3300010399 | Terrestrial Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRVFVAMIQDMHKAFGLNLPG* |
| Ga0134121_127107851 | 3300010401 | Terrestrial Soil | LSGILAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG* |
| Ga0157353_10400021 | 3300012496 | Unplanted Soil | LLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0157338_10036492 | 3300012515 | Arabidopsis Rhizosphere | VGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG* |
| Ga0157305_102478811 | 3300012891 | Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLSLPG* |
| Ga0164241_107176952 | 3300012943 | Soil | MRMLIWIVGLLALGASLDASLWDGAYTRALVGVIQDTHTAIGLK* |
| Ga0164304_115690311 | 3300012986 | Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNL |
| Ga0182008_100287545 | 3300014497 | Rhizosphere | MRVFTWFVALLALCASLDTSLYDGAYTRALVGMVNDAHNAIGLR* |
| Ga0132258_104822183 | 3300015371 | Arabidopsis Rhizosphere | MRMLIWIVGLLALGTSLDSSLYGGAYTRAFVSIIQDTHTAIGLK* |
| Ga0132258_110866353 | 3300015371 | Arabidopsis Rhizosphere | MAVWIVGLLALASTLDTSLNDGAYTRALAGMIQDLYTALGLNRIG* |
| Ga0132256_1006440613 | 3300015372 | Arabidopsis Rhizosphere | LSGILAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQEMHTAIGLKITG* |
| Ga0132256_1017937882 | 3300015372 | Arabidopsis Rhizosphere | MRILTWIIGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG* |
| Ga0132257_1011236813 | 3300015373 | Arabidopsis Rhizosphere | MRMLTWIVGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG* |
| Ga0132257_1020628492 | 3300015373 | Arabidopsis Rhizosphere | MRMLIWIVGLLVLGTSLDSSLYGGAYTRAFVSIIQDTHTAIGLK* |
| Ga0132255_1005394605 | 3300015374 | Arabidopsis Rhizosphere | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQD |
| Ga0132255_1033356262 | 3300015374 | Arabidopsis Rhizosphere | LSGIIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQEMHTAIGLKITG* |
| Ga0173481_100012076 | 3300019356 | Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG |
| Ga0173481_100030104 | 3300019356 | Soil | MRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG |
| Ga0247747_10345821 | 3300022737 | Soil | MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLP |
| Ga0247792_10252731 | 3300022880 | Soil | MRILIWIVGLLALGTSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG |
| Ga0247744_10778591 | 3300023073 | Soil | SASLLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG |
| Ga0207710_104258911 | 3300025900 | Switchgrass Rhizosphere | MRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG |
| Ga0207645_105557001 | 3300025907 | Miscanthus Rhizosphere | MRMLTWIIGLLALGASLDSSLYDGAYTRALVNTIQDM |
| Ga0207660_103207612 | 3300025917 | Corn Rhizosphere | MRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLK |
| Ga0207660_105825532 | 3300025917 | Corn Rhizosphere | MRMLIWIVGLLALGASLDSSLYDGAYTRALVGKIQDTHTAIGLK |
| Ga0207652_116281252 | 3300025921 | Corn Rhizosphere | MRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLK |
| Ga0207711_100488799 | 3300025941 | Switchgrass Rhizosphere | LSGIIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG |
| Ga0207711_116706791 | 3300025941 | Switchgrass Rhizosphere | LLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG |
| Ga0207703_100720756 | 3300026035 | Switchgrass Rhizosphere | IIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG |
| Ga0207594_1000861 | 3300026751 | Soil | SLTIVRHPCPMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG |
| Ga0207559_1022252 | 3300026758 | Soil | MRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMH |
| Ga0207527_1007272 | 3300026759 | Soil | MRILIWIVGLLALGTSLDSSLYDGAYTRALVGKIQDTHTAIGLK |
| Ga0207470_1000481 | 3300026764 | Soil | LTIVRHPCPMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG |
| Ga0207538_10039791 | 3300027122 | Soil | RHPCPMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG |
| Ga0207560_1063821 | 3300027400 | Soil | MRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRA |
| Ga0207522_1005971 | 3300027425 | Soil | IWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG |
| Ga0207622_1001451 | 3300027447 | Soil | PMRILIWIVGLLALGTSLVSSLRGGAYTRAFVTMIQDMHRAFGLHLFG |
| Ga0207981_10169172 | 3300027560 | Soil | MRMLIWIVGLLVLGTSLDSSLYGGAYTQAFVSMIQDTHAAIGLK |
| Ga0209073_104700112 | 3300027765 | Agricultural Soil | MRMAVWIVGLLALATSLDSSLNGGEYTRAFVSMIQDIPSSIGLQRIS |
| Ga0209974_101009521 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MRRLTWIIGLLALGASLDSSLYDGAYTRALVNMIQDMHTAIGLKLTG |
| (restricted) Ga0255311_10124034 | 3300031150 | Sandy Soil | LFGILGPMRKFTWIIGLLALGAALDSSLYDGAYTRAFVYMIQDAHRAVGLK |
| (restricted) Ga0255311_10588201 | 3300031150 | Sandy Soil | LIWIVGLLALATSLDSSLYGGAYTRAFVATIQDMRKAFGLNLPG |
| (restricted) Ga0255310_101339001 | 3300031197 | Sandy Soil | KNRPASLLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG |
| Ga0310813_100124064 | 3300031716 | Soil | MRKLTWIIGLLALGASLDSSLYDGAYTRALVNTIQDMHRAIGLK |
| Ga0310813_119180481 | 3300031716 | Soil | MRMLTWIIGLLALAASLDSSLYDGAYARAFVNAIQDMHTAIGLKMTG |
| Ga0307473_109370712 | 3300031820 | Hardwood Forest Soil | MRILIWIVGLLALGTSLDSSLYGGAYTRAFVTSIQDMHRAFGLHLFG |
| Ga0310903_101454623 | 3300032000 | Soil | MRMLIWIVGLLVLGTSLDSSLYGGAYTRAFVSMIQDTHTAIGLK |
| Ga0310906_109673452 | 3300032013 | Soil | MRMLIWIVGLLALGTSLDSSLYGGAYTRAFVSMIQDTHTAIGLK |
| Ga0310889_101016711 | 3300032179 | Soil | IWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG |
| Ga0307471_1006397491 | 3300032180 | Hardwood Forest Soil | MRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIRDLYAAIGLNRIG |
| Ga0310811_1000755919 | 3300033475 | Soil | LSGIIVAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG |
| Ga0373917_0005777_915_1049 | 3300034692 | Sediment Slurry | MRKFTWIIGLLALGAALDSSLYDGAYTRAFVYLIQDAHRAVGLK |
| ⦗Top⦘ |