


| Basic Information | |
|---|---|
| Family ID | F099325 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MWKRLRHALWRLWRWSRKSPAERRAAKARARFWAEMREGQREAEAHSRP |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.90 % |
| % of genes near scaffold ends (potentially truncated) | 21.36 % |
| % of genes from short scaffolds (< 2000 bps) | 79.61 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (13.592 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (28.155 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.44% β-sheet: 0.00% Coil/Unstructured: 41.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF13560 | HTH_31 | 4.85 |
| PF04041 | Glyco_hydro_130 | 3.88 |
| PF00118 | Cpn60_TCP1 | 2.91 |
| PF06974 | WS_DGAT_C | 2.91 |
| PF00072 | Response_reg | 1.94 |
| PF13439 | Glyco_transf_4 | 1.94 |
| PF02896 | PEP-utilizers_C | 1.94 |
| PF02518 | HATPase_c | 1.94 |
| PF00196 | GerE | 0.97 |
| PF01145 | Band_7 | 0.97 |
| PF00534 | Glycos_transf_1 | 0.97 |
| PF04055 | Radical_SAM | 0.97 |
| PF07859 | Abhydrolase_3 | 0.97 |
| PF12833 | HTH_18 | 0.97 |
| PF10091 | Glycoamylase | 0.97 |
| PF05013 | FGase | 0.97 |
| PF00076 | RRM_1 | 0.97 |
| PF00166 | Cpn10 | 0.97 |
| PF02800 | Gp_dh_C | 0.97 |
| PF13520 | AA_permease_2 | 0.97 |
| PF08937 | DUF1863 | 0.97 |
| PF02639 | DUF188 | 0.97 |
| PF03006 | HlyIII | 0.97 |
| PF01182 | Glucosamine_iso | 0.97 |
| PF02597 | ThiS | 0.97 |
| PF01370 | Epimerase | 0.97 |
| PF13419 | HAD_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 3.88 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.91 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.97 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.97 |
| COG1671 | Uncharacterized conserved protein YaiI, UPF0178 family | Function unknown [S] | 0.97 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.97 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.97 |
| COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.97 |
| COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.11 % |
| Unclassified | root | N/A | 36.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104970021 | Not Available | 531 | Open in IMG/M |
| 3300000550|F24TB_12103283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300003988|Ga0055475_10001191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5309 | Open in IMG/M |
| 3300003988|Ga0055475_10253002 | Not Available | 561 | Open in IMG/M |
| 3300003989|Ga0055473_10002388 | All Organisms → cellular organisms → Bacteria | 4002 | Open in IMG/M |
| 3300003989|Ga0055473_10309336 | Not Available | 522 | Open in IMG/M |
| 3300004000|Ga0055458_10298545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium → Phyllobacterium trifolii | 508 | Open in IMG/M |
| 3300004004|Ga0055451_10001533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9320 | Open in IMG/M |
| 3300004028|Ga0055447_10099438 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300004028|Ga0055447_10245156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300004643|Ga0062591_101311988 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300004643|Ga0062591_102971348 | Not Available | 503 | Open in IMG/M |
| 3300005172|Ga0066683_10901974 | Not Available | 506 | Open in IMG/M |
| 3300005214|Ga0069002_10181100 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005295|Ga0065707_10500365 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005445|Ga0070708_101915640 | Not Available | 549 | Open in IMG/M |
| 3300005471|Ga0070698_102041441 | Not Available | 527 | Open in IMG/M |
| 3300005518|Ga0070699_101709303 | Not Available | 576 | Open in IMG/M |
| 3300005590|Ga0070727_10225146 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005600|Ga0070726_10309726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300005601|Ga0070722_10207729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300005612|Ga0070723_10334881 | Not Available | 721 | Open in IMG/M |
| 3300005825|Ga0074476_1194574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300005828|Ga0074475_10181533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2377 | Open in IMG/M |
| 3300005830|Ga0074473_10077555 | Not Available | 1408 | Open in IMG/M |
| 3300005830|Ga0074473_10760691 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005832|Ga0074469_10338418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300005832|Ga0074469_10395270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales | 5067 | Open in IMG/M |
| 3300005836|Ga0074470_11136096 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005844|Ga0068862_101967555 | Not Available | 595 | Open in IMG/M |
| 3300006467|Ga0099972_10379552 | Not Available | 528 | Open in IMG/M |
| 3300006467|Ga0099972_11925266 | Not Available | 536 | Open in IMG/M |
| 3300006467|Ga0099972_12127738 | Not Available | 685 | Open in IMG/M |
| 3300006845|Ga0075421_100685204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
| 3300006845|Ga0075421_102788814 | Not Available | 503 | Open in IMG/M |
| 3300006847|Ga0075431_101872396 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006876|Ga0079217_11376443 | Not Available | 550 | Open in IMG/M |
| 3300007004|Ga0079218_10134799 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300009053|Ga0105095_10034137 | All Organisms → cellular organisms → Bacteria | 2739 | Open in IMG/M |
| 3300009506|Ga0118657_10002027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 33833 | Open in IMG/M |
| 3300009506|Ga0118657_10008107 | All Organisms → cellular organisms → Bacteria | 16902 | Open in IMG/M |
| 3300009506|Ga0118657_10021624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10137 | Open in IMG/M |
| 3300009506|Ga0118657_10203573 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
| 3300010392|Ga0118731_102461022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300010392|Ga0118731_103530639 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300010392|Ga0118731_104193185 | All Organisms → cellular organisms → Bacteria | 3739 | Open in IMG/M |
| 3300010392|Ga0118731_104588093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1924 | Open in IMG/M |
| 3300010399|Ga0134127_12748381 | Not Available | 572 | Open in IMG/M |
| 3300010413|Ga0136851_10085530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3355 | Open in IMG/M |
| 3300010430|Ga0118733_100295892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3202 | Open in IMG/M |
| 3300010430|Ga0118733_100410503 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
| 3300010430|Ga0118733_101558957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1317 | Open in IMG/M |
| 3300010430|Ga0118733_101812833 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300010430|Ga0118733_104466929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 746 | Open in IMG/M |
| 3300010430|Ga0118733_106135106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300010430|Ga0118733_108783304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300011262|Ga0151668_1103353 | Not Available | 648 | Open in IMG/M |
| 3300012284|Ga0116696_1076706 | Not Available | 626 | Open in IMG/M |
| 3300012284|Ga0116696_1093004 | Not Available | 588 | Open in IMG/M |
| 3300012923|Ga0137359_11371452 | Not Available | 595 | Open in IMG/M |
| 3300013101|Ga0164313_10611400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300015374|Ga0132255_104094992 | Not Available | 619 | Open in IMG/M |
| 3300017657|Ga0134074_1398371 | Not Available | 511 | Open in IMG/M |
| 3300017963|Ga0180437_10489796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300018052|Ga0184638_1227927 | Not Available | 649 | Open in IMG/M |
| 3300018466|Ga0190268_10831471 | Not Available | 705 | Open in IMG/M |
| 3300020063|Ga0180118_1268595 | Not Available | 1179 | Open in IMG/M |
| 3300020063|Ga0180118_1387134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300022214|Ga0224505_10187972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300022220|Ga0224513_10098655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300022306|Ga0224509_10143418 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300022306|Ga0224509_10299417 | Not Available | 584 | Open in IMG/M |
| 3300022389|Ga0210318_1065145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300022413|Ga0224508_10302016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10220573 | Not Available | 867 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10341049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 705 | Open in IMG/M |
| 3300025799|Ga0210122_1006078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3503 | Open in IMG/M |
| 3300025814|Ga0210101_1096056 | Not Available | 779 | Open in IMG/M |
| 3300025883|Ga0209456_10080740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1447 | Open in IMG/M |
| 3300025957|Ga0210089_1041507 | Not Available | 582 | Open in IMG/M |
| 3300025971|Ga0210102_1000802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7636 | Open in IMG/M |
| 3300025983|Ga0210106_1033638 | Not Available | 823 | Open in IMG/M |
| 3300026118|Ga0207675_102164434 | Not Available | 572 | Open in IMG/M |
| 3300027723|Ga0209703_1146135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300027814|Ga0209742_10019521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2249 | Open in IMG/M |
| 3300027820|Ga0209578_10148541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1137 | Open in IMG/M |
| 3300027820|Ga0209578_10205042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 938 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10306190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10024847 | All Organisms → cellular organisms → Bacteria | 2933 | Open in IMG/M |
| 3300027886|Ga0209486_10097653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1554 | Open in IMG/M |
| 3300027917|Ga0209536_101384783 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300027978|Ga0209165_10088751 | Not Available | 1090 | Open in IMG/M |
| (restricted) 3300027997|Ga0255057_10448285 | Not Available | 626 | Open in IMG/M |
| 3300028380|Ga0268265_11768784 | Not Available | 624 | Open in IMG/M |
| 3300028592|Ga0247822_11127160 | Not Available | 652 | Open in IMG/M |
| 3300030619|Ga0268386_10643363 | Not Available | 701 | Open in IMG/M |
| 3300030620|Ga0302046_10180830 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300031368|Ga0307429_1004033 | All Organisms → cellular organisms → Bacteria | 5805 | Open in IMG/M |
| 3300031965|Ga0326597_10045072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5546 | Open in IMG/M |
| 3300032251|Ga0316198_10613674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300033429|Ga0316193_11626139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300033433|Ga0326726_11287145 | Not Available | 711 | Open in IMG/M |
| 3300033489|Ga0299912_10025440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5120 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 13.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 13.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 6.80% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 6.80% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 4.85% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.94% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 1.94% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.94% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.94% |
| Beach Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand | 1.94% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.97% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.97% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.97% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.97% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.97% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
| 3300004028 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005214 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300012284 | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022389 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025799 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025814 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025983 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1049700212 | 3300000364 | Soil | MWKAFREMLVRLWQWSQKSAADRRLAKARARFWADVREGEREAEARLRP* |
| F24TB_121032831 | 3300000550 | Soil | MWKDLRQVLVRLWQWSQKGAAQRRVAKARARFWAGVREGEREAEARSRP* |
| Ga0055475_100011912 | 3300003988 | Natural And Restored Wetlands | MRDALFRFWRWSQKSPAERRAAKARARFWVEMREGQLEAEAHSRP* |
| Ga0055475_102530022 | 3300003988 | Natural And Restored Wetlands | VWKRLRLALSRLWRRSQTGPGERQVARERARFWAEMREGQREAKARARP* |
| Ga0055473_100023883 | 3300003989 | Natural And Restored Wetlands | MWRDVRRVLARLWRWSQKGRAERRAAETRARFWADAREGQLEAEARSRS* |
| Ga0055473_103093361 | 3300003989 | Natural And Restored Wetlands | MWKRMRDALFRFWRWSQKSPAERRAAKARARFWVEVREGQLEAKAHSRP* |
| Ga0055458_102985452 | 3300004000 | Natural And Restored Wetlands | WNELRRLVERLWHRSQRKAAERRAARARARFWAELHEGQREAEIRSRP* |
| Ga0055451_100015332 | 3300004004 | Natural And Restored Wetlands | VRRVLARLWRWSQKGRAERRAAETRARFWADAREGQLEAEARSRS* |
| Ga0055447_100994381 | 3300004028 | Natural And Restored Wetlands | MWKRLRHALWRIWQRSQRGPGERRADKARARFWAEVREGQREAEAHSRP* |
| Ga0055447_102451562 | 3300004028 | Natural And Restored Wetlands | MWKRLHQALRRLWRRSQQGPDERQAARARARFWAEVREGQQEAEARSHP* |
| Ga0062591_1013119882 | 3300004643 | Soil | MWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG* |
| Ga0062591_1029713482 | 3300004643 | Soil | DDLRDVIVRFYRWFQQSAAERRRIKERARFWAGVREGEREAEARTRS* |
| Ga0066683_109019741 | 3300005172 | Soil | MWKRLRHVLWRLVRWSQRARDERRVAETRARFWAEVREGEREAEALSVLKPNHP* |
| Ga0069002_101811002 | 3300005214 | Natural And Restored Wetlands | MWKRLRHALWRLWQRSRRGPGERREAKARARFWAEVREGQREAEARSRP* |
| Ga0065707_105003651 | 3300005295 | Switchgrass Rhizosphere | RRLMRWSQRGRDERRVAETRARFWAEVREGEREAEARSRS* |
| Ga0070708_1019156401 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKRVRHVLWRLMRWSQRGREERRVAETRARFWAEVHEGEREAEARSRS* |
| Ga0070698_1020414411 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MWRRVRHALWRLVRWSQRGRDERRVAETRARFWAEVHEGEREAEARSRS* |
| Ga0070699_1017093032 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKYFRELLVRLWQWSQKSAAERRVAKARARFWAGVREGEREAEAHSRP* |
| Ga0070727_102251462 | 3300005590 | Marine Sediment | MWERLRHALWRLWRRSQTGPDERQAAKARARFWAEMREGQREAEARSRP* |
| Ga0070726_103097263 | 3300005600 | Marine Sediment | MWKRLCDAPFRFWRWSQKSPAERRAAKARARFWVEMREGQREAEAHSRP* |
| Ga0070722_102077291 | 3300005601 | Marine Sediment | MWKRMCDALFRFWRWSQKSPAERRAAKARARFWIELREGQREAEAHLRP* |
| Ga0070723_103348812 | 3300005612 | Marine Sediment | MWRRLHDAFRRLWRRSRRARDEGRLADDRARFWAEVRQGQREAEANSRP* |
| Ga0074476_11945742 | 3300005825 | Sediment (Intertidal) | MWKRLRHALLRLWGWSHKGPAERRAARERARFWAEMREGQREAKAHSRS* |
| Ga0074475_101815334 | 3300005828 | Sediment (Intertidal) | MSETGPGIWDRLRRALERLRSQSQESAQDRRAALARARFWAEVREGEREAEAMSRP* |
| Ga0074473_100775551 | 3300005830 | Sediment (Intertidal) | MLEALRRAVERLWQWSQKTPAERRVAKARARFWAEVREGEREAEGR |
| Ga0074473_107606912 | 3300005830 | Sediment (Intertidal) | MWKRLKHALRRLWRRSQSGADERRVAEERARFWAEVREGQREAEARSRP* |
| Ga0074469_103384182 | 3300005832 | Sediment (Intertidal) | MWERLRDALCRFWRWSQKSPAERRAAKVRARFWVEVREGQREAEAHSRP* |
| Ga0074469_103952702 | 3300005832 | Sediment (Intertidal) | MWKRLRHALWRLWRWSRKGPAERRAARVRARFWAEMREGQREAEARSRP* |
| Ga0074470_111360962 | 3300005836 | Sediment (Intertidal) | MWKRLRRALWRLWQQSQTGRVERQTARERARFWAELREGQREAKAHSRP* |
| Ga0068862_1019675552 | 3300005844 | Switchgrass Rhizosphere | MTAEGLSTMWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG* |
| Ga0099972_103795523 | 3300006467 | Marine | MWKRLRHALWRLWQWSQRGPGERRAAKARARFWAEVRDGQREAEAHSRS* |
| Ga0099972_119252662 | 3300006467 | Marine | MWKRLRHLLWRLWRRSQRSPGERRAAEARARFWAEVREGQREAEAHSRP* |
| Ga0099972_121277382 | 3300006467 | Marine | MWRRLNDALRRLWRRSQRVRAEGRVADDRARFWAEVRQGQREAEANSRL* |
| Ga0075421_1006852042 | 3300006845 | Populus Rhizosphere | VWNRLRHALWRAWRRAQRGADQRRTAEARARFWAEVREGEREAEADSRR* |
| Ga0075421_1027888142 | 3300006845 | Populus Rhizosphere | MWKDLREVLVRLWQWSQKSAADRRLAKARARFWAGVREGEREAEAARLRP* |
| Ga0075431_1018723961 | 3300006847 | Populus Rhizosphere | TWRVLLRTSMLKYLREVLVRLWQWSQKSAAERRVAKERARFWAGVREGEREAESHSRP* |
| Ga0079217_113764432 | 3300006876 | Agricultural Soil | MWNDLREAFVRLRDWAQRGASERRVAKERARFWAGVREGEREAETHSRRERATP* |
| Ga0079218_101347992 | 3300007004 | Agricultural Soil | MWNDLREALVRLRDWAQRGVSERRVAKERARFWAGVREGEREAETHSRRERATP* |
| Ga0105095_100341375 | 3300009053 | Freshwater Sediment | MWERLRHALERLWRRLQSGRRERRTAAARARFWSEVREGQREADADSSP* |
| Ga0118657_100020275 | 3300009506 | Mangrove Sediment | MWKRLRYALWRLWRRSQRSPGERQAAKARARFWAEVREGQREAEAHSRS* |
| Ga0118657_100081076 | 3300009506 | Mangrove Sediment | MWKRLCQALWRLWQQSQGGAEERRTAKARARYWAEVREGEREARAHSRS* |
| Ga0118657_1002162410 | 3300009506 | Mangrove Sediment | MWKRLRSALLRFWQRSQEGSQERHAAKARARYWAEVREGEREAKIHSRP* |
| Ga0118657_102035734 | 3300009506 | Mangrove Sediment | MWKRLRHALRRLLRRSQRSRAELQVAEARARFWAEVREGQREAEARSHP* |
| Ga0118731_1024610222 | 3300010392 | Marine | MWKRLRYALSRLWRRSQSDPGERRVAKARARFWAEVREGQREAEARSRS* |
| Ga0118731_1035306392 | 3300010392 | Marine | MWKRLRQALWRFWQRSQSSPGERRAAKARARFWAEVREGQREAEAHSRS* |
| Ga0118731_1041931855 | 3300010392 | Marine | MLSHRPWGRTSMWKGLRQALARLWRWSQASHAERREAKARARFWAEAREGQREAEAKSRP |
| Ga0118731_1045880931 | 3300010392 | Marine | MWKRICDALFRFWRWSQKSPAERRAAKARARFWIELHEGQREAETHSHP* |
| Ga0134127_127483812 | 3300010399 | Terrestrial Soil | MWNDLREVLVRLWHWSQKSAAERRAAKARARFWADVRAGEREAEAHSRSGRVTP* |
| Ga0136851_100855302 | 3300010413 | Mangrove Sediment | MWKRLRQVLARLWRWSRKSPAERRAARTRARFWAEVREGQREAEARSRP* |
| Ga0118733_1002958926 | 3300010430 | Marine Sediment | MLARLWQSPQKSSAEQRAAAVRARFWAEVREGQREAKARSRP* |
| Ga0118733_1004105032 | 3300010430 | Marine Sediment | MWKDLRRLLTRLWRWSQKGPAERRVTRERARFWAEVREGEREAESSSRP* |
| Ga0118733_1015589571 | 3300010430 | Marine Sediment | MWRGLRRALARLGRWAQKGAVERRAARKRARFWAEVREGQRE |
| Ga0118733_1018128333 | 3300010430 | Marine Sediment | MWKRLQNALRRLWRRSQGGRAEGRVADDRARFWAEVRRGQREAESNSRP* |
| Ga0118733_1044669292 | 3300010430 | Marine Sediment | MDMWKRLRDALWRLWERSQRSPGERREAKARARFWAEVREGQ |
| Ga0118733_1061351061 | 3300010430 | Marine Sediment | MWKRLRHALWRLWRWPQKGPAERRAAKARARFWAEMREGQREAEAHSRP* |
| Ga0118733_1087833042 | 3300010430 | Marine Sediment | MWKGLLQMLARLWQSSQKGSAEQRAAAMRARFWAEVREGQREAETRS |
| Ga0151668_11033532 | 3300011262 | Marine | KRLRYALSRRWRRSQSDPGERRVAKARARFWAEVREGQREAEARSRP* |
| Ga0116696_10767062 | 3300012284 | Beach Sand | MWERLRDALRRLWRRSQRGHDERRAAEARARFWAEVRRGQREAEANSGN* |
| Ga0116696_10930042 | 3300012284 | Beach Sand | MWKRLHHALRRLWNLSQRGRAEGRMANDRARFWAEVRRGQREAEAN |
| Ga0137359_113714521 | 3300012923 | Vadose Zone Soil | MWKRLRHVLWRLVRWSQRARDERRVAETRARFWAEVREGERE |
| Ga0164313_106114001 | 3300013101 | Marine Sediment | MWERICDALSRFWRWSQKSPAERRTDKARARFWHELREGQREAEADSRP* |
| Ga0132255_1040949922 | 3300015374 | Arabidopsis Rhizosphere | MWNDLREVLVRLWQWSRKSAAERRAANARGRFWAGVREGEREAEARPRP* |
| Ga0134074_13983711 | 3300017657 | Grasslands Soil | MWKRLRHVLWRLVRWSQRARDERRVAETRARFWAEVREGER |
| Ga0180437_104897961 | 3300017963 | Hypersaline Lake Sediment | MKRRASMWKLLRYALWRLWRWSRKSPAERRAARTRARFWAEVREGQRE |
| Ga0184638_12279272 | 3300018052 | Groundwater Sediment | MWKYLREVLVRLWQWSQKSAAERRVAKARARFWAGVREGEREAEAHSRP |
| Ga0190268_108314712 | 3300018466 | Soil | MTRGMWRDLREVLVRLWQWSRRSANERRVAKARARFWAGVREGERE |
| Ga0180118_12685952 | 3300020063 | Groundwater Sediment | MLKYLRQVLVRLWQWSRQGAAERRVATARARFWAGVREGEREAEARSRP |
| Ga0180118_13871342 | 3300020063 | Groundwater Sediment | LGTSMWKYFREVLVRLWQWSQKSAAERRVAKARARFWADVREGEREAEAHSRP |
| Ga0224505_101879722 | 3300022214 | Sediment | LGRALWRLWRWSQSGPEERREARARARFWAEVREGQREAKAHSRP |
| Ga0224513_100986552 | 3300022220 | Sediment | MWKRLRHALWRLWRWSRKSPAERRAAKARARFWAEMREGQREAEAHSRP |
| Ga0224509_101434183 | 3300022306 | Sediment | RWSQKSPAERRTDKARARFWHELREGQREAEADSRP |
| Ga0224509_102994171 | 3300022306 | Sediment | MWKRMRHALLRLWRRSQTDPGERRVAEARARFWAEVREGQREAESRSRP |
| Ga0210318_10651451 | 3300022389 | Estuarine | MSETGPGIWDRLRRALERLRSQSQESAQDRRAALARARFWAEVREGEREAEAMSRP |
| Ga0224508_103020162 | 3300022413 | Sediment | MWRRLHDALRRLWRRSRRARDEGRLTEDRARFWAEVRQGEREAEDNSRP |
| (restricted) Ga0255046_102205733 | 3300024519 | Seawater | MYDALFRFWRWSQKSPAERRAAKARARFWVEMREGQREAETHSRP |
| (restricted) Ga0255046_103410492 | 3300024519 | Seawater | MCDALFRFWRWSQKSPAERREAKARARFWVEVREGQREAKDHTRP |
| Ga0210122_10060783 | 3300025799 | Natural And Restored Wetlands | MKRRPRRLRWGTDMRKRMRDALFRFWRWSQKSPAERRAAKARARFWVEMREGQLEAEAHSRP |
| Ga0210101_10960561 | 3300025814 | Natural And Restored Wetlands | MRDALFRFWRWSQKSPAERRAAKARARFWVEMREGQLEAEAHSRP |
| Ga0209456_100807402 | 3300025883 | Pelagic Marine | MWKRLRHALWSLWQRSQSDPDEHRAAEARARFWAEVREGEREAEARSRP |
| Ga0210089_10415072 | 3300025957 | Natural And Restored Wetlands | MWNRLRHALEELWRRSRKGARERRTAEARARFWAEMREGERQAEARCARMDP |
| Ga0210102_10008023 | 3300025971 | Natural And Restored Wetlands | MRDALLRLWRWSQKSPAERRAAKARARFWVEVREGQLEAEAHSRP |
| Ga0210106_10336381 | 3300025983 | Natural And Restored Wetlands | MRDALLRFWRWSQKSPAERRAAKARARFWLELREGQREAEVHSRP |
| Ga0207675_1021644342 | 3300026118 | Switchgrass Rhizosphere | MWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG |
| Ga0209703_11461352 | 3300027723 | Freshwater Sediment | MWERLRHALERLWRRLQSGRRERRTAAARARFWSEVREGQREADADSSP |
| Ga0209742_100195211 | 3300027814 | Marine Sediment | MWKRLRYALSRLWRRSQSDPGERRVAKERARFWAEVREGQREAEARSRS |
| Ga0209578_101485411 | 3300027820 | Marine Sediment | PASASAMWGTDMWKRLRHALWRLWRRSQRSPGERRVAKERARFWAEVREGQREAEAHSRP |
| Ga0209578_102050422 | 3300027820 | Marine Sediment | MWERLRHALWRLWRRSQTGPDERQAAKARARFWAEMREGQREAEARSRP |
| (restricted) Ga0255052_103061902 | 3300027865 | Seawater | MWTRLRHALSRFWQWSQKGPAERRVEKARARFWAEAREGQREAEARSRP |
| (restricted) Ga0255058_100248472 | 3300027872 | Seawater | MWKRLEHVLGRLWRWSQMSPAERRAARVRARFWADMRAGQREAEARSRP |
| Ga0209486_100976532 | 3300027886 | Agricultural Soil | EQIIQTWREQRNTMWNDLREALVRLRDWAQRGVSERRVAKERARFWAGVREGEREAETHSRRERATP |
| Ga0209536_1013847831 | 3300027917 | Marine Sediment | MWKRLEDALRRLWRWAKKSPAERRAARVRARFWADLRAGQREAEARSRP |
| Ga0209165_100887513 | 3300027978 | Marine Sediment | MWKRMCDALFRFWRWSQKSPAERRAAKARARFWIELREGQREAEAHLRP |
| (restricted) Ga0255057_104482852 | 3300027997 | Seawater | MWEGLRQALARLWKRSQKGRAEARAVEARARFWAELREGQREAEAHSRP |
| Ga0268265_117687842 | 3300028380 | Switchgrass Rhizosphere | MTAEGLSTMWNDLREVLVRLWHWSQKSAAERRAAKVRARFWADVRAGEREAEAHSRSG |
| Ga0247822_111271603 | 3300028592 | Soil | LGVWSRLRNALSSLWRWSRSVRDERRSTKARALFWSEVREGEREAEANADPDRVR |
| Ga0268386_106433632 | 3300030619 | Soil | MWNDLREVLVRLWQWSQKSAAERRVGKARARFWADVREGEREAEARSRL |
| Ga0302046_101808304 | 3300030620 | Soil | MYTKQWKRLREALSWLWRWSQRGRNERRVVKARARFWAEVHEGEREAEARLHP |
| Ga0307429_10040332 | 3300031368 | Salt Marsh | MWRGLRHGLWRLWRRSQKGREERRTLKARARFWAEVREGQREAAARTGR |
| Ga0326597_100450723 | 3300031965 | Soil | MWKHLRQALWRLWRSPQRGVGERRAAKARARFWAEVRKGQREAEAHSRP |
| Ga0316198_106136742 | 3300032251 | Sediment | MWERLRRALRRVWRRSQRGPGECREAEARARFWAEVRDGEREAEAQSRP |
| Ga0316193_116261391 | 3300033429 | Sediment | MWKRLRHALRSLWRRSQSDPGERGVAEARARFWAEVHEGEREAEARSRP |
| Ga0326726_112871451 | 3300033433 | Peat Soil | MRIRHSLVVIWRRLKQGGDERRTADARARFWADVREGEREAEARSRP |
| Ga0299912_100254405 | 3300033489 | Soil | MWKRLRHVLWRLWQRSKRGPGERRAAKARARFWDEVREGQREAEAHSRP |
| ⦗Top⦘ |