


| Basic Information | |
|---|---|
| Family ID | F099266 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQKEIYKEDYFGTLMCILVDESRRMMPTFNPTKELHKIQNDM |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.50 % |
| % of genes near scaffold ends (potentially truncated) | 66.99 % |
| % of genes from short scaffolds (< 2000 bps) | 68.93 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.456 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (16.505 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.845 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.233 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00082 | Peptidase_S8 | 7.77 |
| PF10431 | ClpB_D2-small | 2.91 |
| PF07486 | Hydrolase_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.11 % |
| Unclassified | root | N/A | 36.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10036359 | All Organisms → Viruses → Predicted Viral | 2631 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10209192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300000167|SI39nov09_120mDRAFT_c1094833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300001450|JGI24006J15134_10155848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300001460|JGI24003J15210_10096328 | Not Available | 857 | Open in IMG/M |
| 3300005523|Ga0066865_10134556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300006025|Ga0075474_10273771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300006735|Ga0098038_1083366 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300006947|Ga0075444_10170183 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300007345|Ga0070752_1327129 | Not Available | 579 | Open in IMG/M |
| 3300007539|Ga0099849_1081350 | All Organisms → Viruses → Predicted Viral | 1310 | Open in IMG/M |
| 3300009071|Ga0115566_10607830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300009124|Ga0118687_10279238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300009124|Ga0118687_10314557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300009193|Ga0115551_1119983 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300009420|Ga0114994_10920167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 566 | Open in IMG/M |
| 3300009425|Ga0114997_10187583 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300009426|Ga0115547_1206894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300009433|Ga0115545_1202919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300009433|Ga0115545_1302307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300009505|Ga0115564_10597983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300009512|Ga0115003_10660245 | Not Available | 609 | Open in IMG/M |
| 3300009703|Ga0114933_10722194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 638 | Open in IMG/M |
| 3300011252|Ga0151674_1064366 | Not Available | 661 | Open in IMG/M |
| 3300012928|Ga0163110_11075490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300012928|Ga0163110_11174681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300012953|Ga0163179_12279979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300012954|Ga0163111_10554358 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300012954|Ga0163111_11758055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300012954|Ga0163111_12498538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300016791|Ga0182095_1030039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300017708|Ga0181369_1036947 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300017714|Ga0181412_1088953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 735 | Open in IMG/M |
| 3300017743|Ga0181402_1140024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 616 | Open in IMG/M |
| 3300017743|Ga0181402_1149195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300017748|Ga0181393_1051453 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300017749|Ga0181392_1167691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300017755|Ga0181411_1134338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 718 | Open in IMG/M |
| 3300017768|Ga0187220_1061083 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300017769|Ga0187221_1144668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 706 | Open in IMG/M |
| 3300017771|Ga0181425_1230213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 576 | Open in IMG/M |
| 3300017771|Ga0181425_1283784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300017781|Ga0181423_1322989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300017818|Ga0181565_10433566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300017985|Ga0181576_10811949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300018048|Ga0181606_10572690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300018417|Ga0181558_10351099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300018420|Ga0181563_10349046 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300018420|Ga0181563_10612418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300018420|Ga0181563_10788872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300018876|Ga0181564_10624550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300019765|Ga0194024_1091464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300020385|Ga0211677_10119858 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300020446|Ga0211574_10459217 | Not Available | 548 | Open in IMG/M |
| 3300020451|Ga0211473_10169603 | Not Available | 1124 | Open in IMG/M |
| 3300020465|Ga0211640_10556207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300020474|Ga0211547_10107860 | All Organisms → Viruses → Predicted Viral | 1458 | Open in IMG/M |
| 3300020475|Ga0211541_10601109 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 534 | Open in IMG/M |
| 3300020595|Ga0206126_10352260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300020601|Ga0181557_1155297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
| 3300021389|Ga0213868_10383883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
| 3300021957|Ga0222717_10526613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300021959|Ga0222716_10160130 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
| 3300022922|Ga0255779_1111534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1407 | Open in IMG/M |
| 3300022923|Ga0255783_10325025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300023108|Ga0255784_10423196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 628 | Open in IMG/M |
| 3300025151|Ga0209645_1175805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300025894|Ga0209335_10216218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300027779|Ga0209709_10432396 | Not Available | 510 | Open in IMG/M |
| 3300027788|Ga0209711_10341590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300027847|Ga0209402_10680189 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300029318|Ga0185543_1115926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.50% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 16.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.77% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 6.80% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.83% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.94% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.94% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.94% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.97% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.97% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.97% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.97% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.97% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.97% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.97% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.97% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.97% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000167 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100363591 | 3300000101 | Marine | MQKDIFKEDYFGTLMCILVDESRRILPTFKTTKDL |
| DelMOWin2010_102091921 | 3300000117 | Marine | MQKDIYKEDYFGTLMCILIDESRRIMPTFNPTPELHKIQAD |
| SI39nov09_120mDRAFT_10948331 | 3300000167 | Marine | MQKEIYKEDYFGTLMCILVDESRRMMPTFNPTKELHKIQNDMCKAGS |
| JGI20155J14468_101463471 | 3300001354 | Pelagic Marine | MQKEIYKEDYFGTLMCILVDESRRILPTFNTTKELHK |
| JGI24006J15134_101558481 | 3300001450 | Marine | MQKEIYNENYFGTLMCILVDESRRIMSTFNPTPELHKFQNDMCKAGS |
| JGI24003J15210_100435765 | 3300001460 | Marine | MQKDILQEDYFGTLMSILVDESRRMMPTFNPTAESHKI |
| JGI24003J15210_100963281 | 3300001460 | Marine | MQKEIYKEDYFGTLMCILVDESRRMMPTFNPTAESHKIQNDMCKAG |
| Ga0066865_101345561 | 3300005523 | Marine | MQKDIYKEDYFGTLMCILIEESRKIMPTFNPTPELHKIQADMCAAG |
| Ga0075474_102737712 | 3300006025 | Aqueous | MQKDIYKENYFGTLMCILVDESRRMMSTFMPTPELHKIQ |
| Ga0100228_11485341 | 3300006565 | Marine | MQKEIYKEDYFGTLMSVLVDESRKLLPEFNPTEETHKIQNDMCKA |
| Ga0098038_10833662 | 3300006735 | Marine | MQKEIYKEDYFGTLMCILVDESRRIMPTFNPTPELHKI |
| Ga0098037_12354592 | 3300006737 | Marine | MQKEIYKEDYFGTLMCILVDESRKIMSTFNPTKELHKIQN |
| Ga0070746_101214581 | 3300006919 | Aqueous | MQKEIYKENYFGTLMCILVDESRRMMSTFNPTPELHKIQNNMCK |
| Ga0075444_101701833 | 3300006947 | Marine | MQKEIHKEDYFGTLMSILVDESRRMMSTFNPTAETHKIQN |
| Ga0070747_10319492 | 3300007276 | Aqueous | MQKEIYKEDYFGTLMCILVDESRRMMSTFNPTKELHKIQ |
| Ga0070752_13271292 | 3300007345 | Aqueous | MQKDIYKEDYFGTLMCILVDESRRMMSTFMPTPTLHKIQNDMCQAVVG* |
| Ga0099849_10813501 | 3300007539 | Aqueous | MQKDIYKEDYFGTLMCILIDESRRIMPTFNPTPELHKIQADMCVAGDW |
| Ga0115566_106078302 | 3300009071 | Pelagic Marine | MQKDIYKEDYFGTLMCILMDESRRMMSTFMPTPELHKI |
| Ga0118687_102792381 | 3300009124 | Sediment | MQKDIYKEDYFGTLMCILVDESRRMMSTFMPTPELHKIQNDMCRA |
| Ga0118687_103145571 | 3300009124 | Sediment | MQKEIYKENYFGTLMCILVDESRRIMPTFMPTPELHKIQNLSLIHI* |
| Ga0115551_11199832 | 3300009193 | Pelagic Marine | MQKEIYKEDYFGTLMCILVDESRRILPTFKTTKNLHKIQND |
| Ga0114994_109201672 | 3300009420 | Marine | MQKEIYKEDYFGTLMSILVDESRRMMSTFNPTAETQKI |
| Ga0114997_101875831 | 3300009425 | Marine | MQKEIHKEDYFGTLMSVLVDESRRMMSTFNPTAETHKIQNDMCKAGTW |
| Ga0115547_12068942 | 3300009426 | Pelagic Marine | MQKDVSKESYFGTLMSILIDESRRILPTFNATPELHKIQNNMCRAGSWI |
| Ga0115545_12029192 | 3300009433 | Pelagic Marine | MQKDISKESYFGTLMCILIDESRRILPTFNATPELHKIQNDMCRAGSWIDNM |
| Ga0115545_13023071 | 3300009433 | Pelagic Marine | MQKDIYKEDYFGTLMCILMDESRRTMSTFMPTPELHKIQN |
| Ga0115556_10101227 | 3300009437 | Pelagic Marine | MQKEIFKEDYFGTLMCILVDESRRMMPTFNPTKESHKIQND |
| Ga0115564_105979831 | 3300009505 | Pelagic Marine | MQKEIHKEDYFGTLMSILVDESRRMMSTFNPTAETHKIQNDMCKAGT |
| Ga0115003_100567635 | 3300009512 | Marine | MQKDILQEDYFGTLMSILVDESRRMMPTFNPTAESHK |
| Ga0115003_106602453 | 3300009512 | Marine | MKEIFKEDYFGTLMSILVDESRRMMSTFNPTAETHKIQNDMCKAGTWLTQ |
| Ga0114933_107221941 | 3300009703 | Deep Subsurface | MQKEIYKEDYFGTLMSVLVDESRRMMPTFNPTKELHKIQNDMCK |
| Ga0151674_10643661 | 3300011252 | Marine | MQKEIHNEDYFGTLMCILVDESRRMMPTFNPTKESH |
| Ga0160423_101182112 | 3300012920 | Surface Seawater | MQKDIYKEDYFGTLMCILVDESRRIMPTFNPTPELHKI |
| Ga0163110_110754901 | 3300012928 | Surface Seawater | MQKDIYKEDYFGTLMCILVDESRKFLPTFMPTKELHKIQNDMCVA |
| Ga0163110_111746812 | 3300012928 | Surface Seawater | MQKEIYKEDYFGTLMCVLVDESRRIMPTFNPTKELHKI |
| Ga0163179_122799792 | 3300012953 | Seawater | MQKEIHKEDYFGTLMSVLVDESRKMMPTFNPTQELHKIQ |
| Ga0163111_101170411 | 3300012954 | Surface Seawater | MVKIIDNEDYFGTLMCVLTDESRRILPKFMPTQRLHKIQNDMC |
| Ga0163111_105543582 | 3300012954 | Surface Seawater | MQKEIYKEDYFGTLMSVLVDESRRLLPVFNPTPELYKIQNDM* |
| Ga0163111_117580552 | 3300012954 | Surface Seawater | MQKDIHKEDYFGTLMCILVDESRRIMPTFNPTKELHKIQN |
| Ga0163111_124985382 | 3300012954 | Surface Seawater | MQKEIYKEDYFGTLMCVLVDECRKKLSKFNPTKELYKI |
| Ga0182078_108030431 | 3300016747 | Salt Marsh | MQKEIYKEDYFGTLMCILIDHSRKLLPTFNPTERLHKIQNDMCKAGSW |
| Ga0182095_10300391 | 3300016791 | Salt Marsh | MQKDIYTENYFGTLMCILVDESRRMMSTFMPTPELHK |
| Ga0181369_10369474 | 3300017708 | Marine | MQREIYKEDYFGTLMCVLVDESRRLMPTFNPNEEAHKIQSDMCEA |
| Ga0181403_11123921 | 3300017710 | Seawater | MQKDIYKEDYFGTVMCILIDEARKFLPSYKPTSDVHKV |
| Ga0181412_10889532 | 3300017714 | Seawater | MQKEIYKEDYFGTLMCIMVDESRRMMSTFNPTKELHKL |
| Ga0181398_10236151 | 3300017725 | Seawater | MQKEIHKEDYFGTLMCILVDESRRIMPTFNPTKEL |
| Ga0181418_11538363 | 3300017740 | Seawater | MQKEIFKEDYFGTLMSVLVDECRRILPTFNPTQEA |
| Ga0181402_11400241 | 3300017743 | Seawater | MQKEIYKEDYFGTLMCILVDESRRMMPTFNPTKELHKIQNDM |
| Ga0181402_11491952 | 3300017743 | Seawater | MQKEIYKENYFGTLMCILVDESRRIMSTFNPTPEL |
| Ga0181393_10514531 | 3300017748 | Seawater | MQKEIYKEDYFGTLMCILVDESRRIMSTFNPTPELHKIQN |
| Ga0181392_11676912 | 3300017749 | Seawater | MQKEIYKEDYFGTLMCILVDESRRMMSTFNPTKEL |
| Ga0181411_11343381 | 3300017755 | Seawater | MQKEIHKEDYFGTLMSVLVDESRRIMPTFNPTKELHKIQ |
| Ga0181422_11537131 | 3300017762 | Seawater | MQREIFKEDYFGTLMSVLVDECRRMLQTFNPTQEAHKIQNDMCKAGT |
| Ga0187220_10610832 | 3300017768 | Seawater | MQKEIYKEDYFGTLMCILVDESRRIMSTFNPTKQLHKIQN |
| Ga0187221_11446683 | 3300017769 | Seawater | MQKEIHKEDYFGTLMCILVDESRRIMSTFNPTKQLHKIQNDMCKAGSWI |
| Ga0181425_12302132 | 3300017771 | Seawater | MQKEIHKEDYFGTLMCILVDESRRIMPTFNPTKELHKIQNDMCKAGSWI |
| Ga0181425_12837842 | 3300017771 | Seawater | MQKEIYKEDYFGTLMCILVDESRRIMPTFNPTPELHKIQ |
| Ga0181423_13229892 | 3300017781 | Seawater | MQKEIYKENYFGTLMCILVDESRRIMSTFNPTPELHKIQ |
| Ga0181565_104335662 | 3300017818 | Salt Marsh | MQKDIYKENYFGTLMCILVDESRRMMSTFMPTPELHKIQNDMCRAGSW |
| Ga0181576_108119492 | 3300017985 | Salt Marsh | MQKDIYKEDYFGTLMCILIDESRRIMPTFNPTPELH |
| Ga0181606_105726901 | 3300018048 | Salt Marsh | MQKDIYKENYFGTLMCILVDESRRMMSTFMPTPELHK |
| Ga0181558_101235281 | 3300018417 | Salt Marsh | MQKDIYKEDYFGTLMCILIDESRRIMPTFNPTPELHKIQADMCAA |
| Ga0181558_103510992 | 3300018417 | Salt Marsh | MQKEVYKEDYFGTLMSILVDESRKKLPTFNPTKELHKIQNDMC |
| Ga0181567_101176352 | 3300018418 | Salt Marsh | MQKEIYKEDYFGTLFCVLVDESRKILPKFMPTKELHKIQNDMCVAG |
| Ga0181563_103490461 | 3300018420 | Salt Marsh | MQKDIYKEDYFGTLMCILIDESRRIMPTFNPTPELHKIQADMCA |
| Ga0181563_106124182 | 3300018420 | Salt Marsh | MQKDIYKENYFGTLMCILVDESRRMMSTFMPTPELHKIQNDMCRAGS |
| Ga0181563_107888721 | 3300018420 | Salt Marsh | MQKDIYKEDYFGTLMCILIDESRRIMPTFNPTPELHKIQADMCAAGD |
| Ga0181566_100552761 | 3300018426 | Salt Marsh | MQKDIYKEDYFGTLMCILVDESRRLMPTFNPTPELHKIQADMCAAGDWLPKVP |
| Ga0181564_106245502 | 3300018876 | Salt Marsh | MQKDIYKENYFGTLMCILVDESRRTMSTFMPTPELHKIQ |
| Ga0194024_10914642 | 3300019765 | Freshwater | MQKEIYKEDYFGTLMCILIDHSRKLLPTFNPTERL |
| Ga0206128_11649983 | 3300020166 | Seawater | MQKDIFKEDYFGTLMCILVDESRRILPTFKTTKNLHKIQNDMCKAG |
| Ga0206129_103983291 | 3300020182 | Seawater | MQKDIFKEDYFGTLMCILVDESRRILPTFKTTKNLHKIQNDM |
| Ga0211677_101198581 | 3300020385 | Marine | MQKEIYKENYFGTLMCILVDESRRMMSTFNPTPEL |
| Ga0211678_103565591 | 3300020388 | Marine | MQKEIYKENYFGTLMCILVDESRRIMSTFNPTAESH |
| Ga0211559_101107241 | 3300020442 | Marine | MQKDIFKEDYFGTLFCVLVDESRKLMPEFTPTALLHQ |
| Ga0211574_104592172 | 3300020446 | Marine | MQKDIFKEDYFGTLMCILVDESRKLLPTFKPTPELHKIQNDMCVAGTWIDKIP |
| Ga0211473_101696034 | 3300020451 | Marine | MQREIFKEDYFGTLMSVLVDECRRMLPTFNPTQEAHKIQNDMCKAGTWID |
| Ga0211640_105562072 | 3300020465 | Marine | MQKEIYKEDYFGTLMSILVDESRKLLPTFNPTKELHKIQND |
| Ga0211547_101078602 | 3300020474 | Marine | MQKEIYNEDYFGTLMSVLVDESRRMMPTFNPTPELHKTQNDMCKAGSWID |
| Ga0211547_101433801 | 3300020474 | Marine | MQKEIHREDYFGTLMSVLVDESRKILPTFMPTEELHKIQNDMCKAG |
| Ga0211541_106011091 | 3300020475 | Marine | MQKEIYKEDYFGTLMSILVDESRKILPTFNPTPELHKIQNDMCKAGSW |
| Ga0206126_103522601 | 3300020595 | Seawater | MQKEIFKEDYFGTLMCILVDESRKMMPTFNPTPELHKTQNDM |
| Ga0181557_11552971 | 3300020601 | Salt Marsh | MQKEIYKEDYFGTLMCILIDHSRKLLPTFNPTERLHQIQNDMCKAGSWIDNM |
| Ga0213868_103838831 | 3300021389 | Seawater | MQKEIYKEDYFGTLMCILVDESRRMMSTFNPTKELH |
| Ga0226832_105008142 | 3300021791 | Hydrothermal Vent Fluids | MQKDIYKEDYFQTLMCVLVDESRKLMPSFNPTSEAHRINKEMSKAG |
| Ga0222717_105266132 | 3300021957 | Estuarine Water | MQKDIYKENYFGTLMCILVDESRRMMSTFMPTPELHKIQN |
| Ga0222716_101601302 | 3300021959 | Estuarine Water | MQKDIYKEDYFGTLMCILVDESRRMMSTFNPTPELHKIQNDMCVAGSWID |
| Ga0255779_11115342 | 3300022922 | Salt Marsh | MQKEIYKEDYFGTLMCILIDHSRKLLPTFNPTERLHQIQNDMCKAGSWIDN |
| Ga0255783_103250251 | 3300022923 | Salt Marsh | MQKEIYKEDYFGTLFCVLVDESRKILPKFMPTKELHKIQNDMCVAGSWI |
| Ga0255784_104231961 | 3300023108 | Salt Marsh | MQKEIYKEDYFGTLFCVLVDESRKILPKFMPTKELH |
| Ga0209645_11758051 | 3300025151 | Marine | MQKEIYKEDYFGTLMCILIDESRKFLPKFMPTKELHKIQNDMCKAGSWID |
| Ga0209337_10057361 | 3300025168 | Marine | MQKEIFKEDYFGTLMSILVDESRRMMPTFNPTAETHKIQNDMCKA |
| Ga0209197_10918091 | 3300025637 | Pelagic Marine | MQKDIFKEDYFGTLMCILVDESRRILPTFKTTKNLHKIQND |
| Ga0208767_10891042 | 3300025769 | Aqueous | MQKEIYKENYFGTLMCILVDESRRMMSTFNPTPELHKI |
| Ga0209119_13547772 | 3300025860 | Pelagic Marine | MQKDIFKEDYFGTLMCILVDESRRILPTFKTTKDLHKIQ |
| Ga0209335_102162181 | 3300025894 | Pelagic Marine | MQKEIYKEDYFGTLMCILVDESRRIMSTFNPTPVLHKIQNDMCRAG |
| Ga0209709_104323963 | 3300027779 | Marine | MKEIFKEDYFGTLMSILVDESRRMMSTFNPTAETHKIQNDMCKAGTWLT |
| Ga0209711_103415902 | 3300027788 | Marine | MQKEIYKEDYFGTLMSVLVDESRRMMSTFNPTAETQKIQNDMCKA |
| Ga0209402_106801891 | 3300027847 | Marine | MQKEIYKEDYFGTLMSVLVDESRRMMPTFNPTAESHKIQNDMCKAGTWL |
| Ga0185543_11159261 | 3300029318 | Marine | MQKDIYKEDYFGTLMCILIDESRKFLPTFMPTKELHKIQNDMC |
| Ga0308022_10445272 | 3300031142 | Marine | MQKEIYKEDYFGTLMSVLVDESRRMMSTFNPTAETHKIQNDMCKA |
| Ga0307488_101455254 | 3300031519 | Sackhole Brine | MKEIFKEDYFGTLMSILVDESRRMMSTFNPTAETHKIQNDMCKAG |
| Ga0302118_103211711 | 3300031627 | Marine | MQKDILQEDYFGTLMSILVDESRRMMPTFNPTAESHKIQNDMCKAG |
| ⦗Top⦘ |