


| Basic Information | |
|---|---|
| Family ID | F099243 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRNPPILISVIGFFAALAGFGFLFYGLRVIGFDWFGALGD |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.03 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.09 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.019 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.330 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.155 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF09851 | SHOCT | 10.68 |
| PF12833 | HTH_18 | 4.85 |
| PF13180 | PDZ_2 | 2.91 |
| PF13191 | AAA_16 | 1.94 |
| PF02627 | CMD | 1.94 |
| PF08818 | DUF1801 | 1.94 |
| PF05988 | DUF899 | 1.94 |
| PF02678 | Pirin | 1.94 |
| PF12697 | Abhydrolase_6 | 1.94 |
| PF00196 | GerE | 0.97 |
| PF05235 | CHAD | 0.97 |
| PF12680 | SnoaL_2 | 0.97 |
| PF00155 | Aminotran_1_2 | 0.97 |
| PF00520 | Ion_trans | 0.97 |
| PF13401 | AAA_22 | 0.97 |
| PF03606 | DcuC | 0.97 |
| PF08031 | BBE | 0.97 |
| PF00528 | BPD_transp_1 | 0.97 |
| PF01061 | ABC2_membrane | 0.97 |
| PF13460 | NAD_binding_10 | 0.97 |
| PF04525 | LOR | 0.97 |
| PF00296 | Bac_luciferase | 0.97 |
| PF12681 | Glyoxalase_2 | 0.97 |
| PF01872 | RibD_C | 0.97 |
| PF12840 | HTH_20 | 0.97 |
| PF14026 | DUF4242 | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF00884 | Sulfatase | 0.97 |
| PF04402 | SIMPL | 0.97 |
| PF12867 | DinB_2 | 0.97 |
| PF01810 | LysE | 0.97 |
| PF03350 | UPF0114 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.94 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 1.94 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.94 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.94 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.94 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.94 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.97 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.97 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.97 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.97 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG2862 | Uncharacterized membrane protein YqhA | Function unknown [S] | 0.97 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.97 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.97 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.97 |
| COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 0.97 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.02 % |
| Unclassified | root | N/A | 33.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01CZG8M | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0828443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300000891|JGI10214J12806_10384332 | Not Available | 501 | Open in IMG/M |
| 3300000891|JGI10214J12806_10435541 | Not Available | 586 | Open in IMG/M |
| 3300000891|JGI10214J12806_10880474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides halotolerans | 1117 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101475316 | Not Available | 812 | Open in IMG/M |
| 3300003858|Ga0031656_10118296 | Not Available | 949 | Open in IMG/M |
| 3300004156|Ga0062589_101791285 | Not Available | 616 | Open in IMG/M |
| 3300004156|Ga0062589_101895121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300004157|Ga0062590_102017188 | Not Available | 599 | Open in IMG/M |
| 3300004479|Ga0062595_101209449 | Not Available | 671 | Open in IMG/M |
| 3300004643|Ga0062591_100122208 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300005345|Ga0070692_10678487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300005356|Ga0070674_100915882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 764 | Open in IMG/M |
| 3300005366|Ga0070659_101996070 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005466|Ga0070685_11188371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
| 3300005615|Ga0070702_101877897 | Not Available | 502 | Open in IMG/M |
| 3300005833|Ga0074472_11196385 | Not Available | 541 | Open in IMG/M |
| 3300005843|Ga0068860_102498078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 536 | Open in IMG/M |
| 3300006049|Ga0075417_10194290 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300006051|Ga0075364_10449908 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300006581|Ga0074048_12640415 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300009094|Ga0111539_13306015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
| 3300009101|Ga0105247_10980251 | Not Available | 659 | Open in IMG/M |
| 3300009148|Ga0105243_12618340 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009789|Ga0126307_10883760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300010366|Ga0126379_13177880 | Not Available | 550 | Open in IMG/M |
| 3300010397|Ga0134124_11792913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300010400|Ga0134122_13076639 | Not Available | 521 | Open in IMG/M |
| 3300010401|Ga0134121_12561803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300010403|Ga0134123_11352560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300012469|Ga0150984_105441571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300012884|Ga0157300_1054302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300012885|Ga0157287_1102836 | Not Available | 533 | Open in IMG/M |
| 3300012909|Ga0157290_10480485 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012955|Ga0164298_10581817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 765 | Open in IMG/M |
| 3300012961|Ga0164302_11728564 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012985|Ga0164308_11542000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300012987|Ga0164307_10356082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1064 | Open in IMG/M |
| 3300012988|Ga0164306_11446582 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012989|Ga0164305_11660773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 572 | Open in IMG/M |
| 3300014272|Ga0075327_1328860 | Not Available | 514 | Open in IMG/M |
| 3300014316|Ga0075339_1225337 | Not Available | 536 | Open in IMG/M |
| 3300014326|Ga0157380_11860389 | Not Available | 662 | Open in IMG/M |
| 3300015200|Ga0173480_10122745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 8AM | 1292 | Open in IMG/M |
| 3300015200|Ga0173480_10828772 | Not Available | 593 | Open in IMG/M |
| 3300015201|Ga0173478_10163428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 898 | Open in IMG/M |
| 3300015371|Ga0132258_10874635 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
| 3300015371|Ga0132258_11572996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1660 | Open in IMG/M |
| 3300015372|Ga0132256_103042568 | Not Available | 564 | Open in IMG/M |
| 3300015373|Ga0132257_104025200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18 | 535 | Open in IMG/M |
| 3300015374|Ga0132255_104372165 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300016294|Ga0182041_11269897 | Not Available | 673 | Open in IMG/M |
| 3300016319|Ga0182033_11692451 | Not Available | 573 | Open in IMG/M |
| 3300016387|Ga0182040_11103872 | Not Available | 665 | Open in IMG/M |
| 3300016404|Ga0182037_11829528 | Not Available | 543 | Open in IMG/M |
| 3300018060|Ga0187765_10071347 | Not Available | 1835 | Open in IMG/M |
| 3300018060|Ga0187765_10300965 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300018432|Ga0190275_13045472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300018469|Ga0190270_10806654 | Not Available | 946 | Open in IMG/M |
| 3300018481|Ga0190271_10030816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4320 | Open in IMG/M |
| 3300018481|Ga0190271_10489761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1339 | Open in IMG/M |
| 3300019356|Ga0173481_10696088 | Not Available | 548 | Open in IMG/M |
| 3300019362|Ga0173479_10422848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 649 | Open in IMG/M |
| 3300022911|Ga0247783_1225881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 540 | Open in IMG/M |
| 3300022915|Ga0247790_10195845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides halotolerans | 535 | Open in IMG/M |
| 3300023077|Ga0247802_1041828 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300025916|Ga0207663_10279560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18 | 1239 | Open in IMG/M |
| 3300025923|Ga0207681_10162768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1684 | Open in IMG/M |
| 3300025924|Ga0207694_11260210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300025930|Ga0207701_10189666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1811 | Open in IMG/M |
| 3300026041|Ga0207639_12268724 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026062|Ga0208654_1011512 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300027907|Ga0207428_10460712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300028381|Ga0268264_10279481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1563 | Open in IMG/M |
| 3300028590|Ga0247823_10997486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 628 | Open in IMG/M |
| 3300028755|Ga0307316_10249558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
| 3300028803|Ga0307281_10035890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1508 | Open in IMG/M |
| 3300028803|Ga0307281_10139152 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300028856|Ga0302295_1033506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1028 | Open in IMG/M |
| 3300028875|Ga0307289_10089376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1252 | Open in IMG/M |
| 3300029923|Ga0311347_10124252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1601 | Open in IMG/M |
| 3300030048|Ga0302273_1029840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300030673|Ga0302287_10248612 | Not Available | 522 | Open in IMG/M |
| 3300030990|Ga0308178_1050690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 775 | Open in IMG/M |
| 3300031728|Ga0316578_10141917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1447 | Open in IMG/M |
| 3300031797|Ga0318550_10454095 | Not Available | 619 | Open in IMG/M |
| 3300031873|Ga0315297_11473643 | Not Available | 550 | Open in IMG/M |
| 3300031997|Ga0315278_10888745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300032001|Ga0306922_11808611 | Not Available | 601 | Open in IMG/M |
| 3300032003|Ga0310897_10403470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300032010|Ga0318569_10492866 | Not Available | 571 | Open in IMG/M |
| 3300032013|Ga0310906_10688509 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300032059|Ga0318533_11202611 | Not Available | 554 | Open in IMG/M |
| 3300032143|Ga0315292_10051579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3048 | Open in IMG/M |
| 3300032143|Ga0315292_11297652 | Not Available | 596 | Open in IMG/M |
| 3300032211|Ga0310896_10623416 | Not Available | 604 | Open in IMG/M |
| 3300032275|Ga0315270_10116538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1579 | Open in IMG/M |
| 3300032275|Ga0315270_10634345 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300033408|Ga0316605_12091125 | Not Available | 551 | Open in IMG/M |
| 3300033416|Ga0316622_100680169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1189 | Open in IMG/M |
| 3300034090|Ga0326723_0378401 | Not Available | 641 | Open in IMG/M |
| 3300034151|Ga0364935_0119889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.97% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.97% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.97% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028856 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030673 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_02789340 | 2189573000 | Grass Soil | VRNPPILISVIGFFAALAGFGYLFFGLRVIGFDWFGIFGD |
| ICChiseqgaiiDRAFT_08284431 | 3300000033 | Soil | MRNPPILVSVIGFFGAIAGFYWIYLGLRLLGFDWFGVLGDLE |
| JGI10214J12806_103843322 | 3300000891 | Soil | MKNPPILISVIGFFAALAGVSYLFFGLSALGFDWFGALGDLPKYE |
| JGI10214J12806_104355411 | 3300000891 | Soil | MRNPPILVSVIGFFAAIAGFYWIYLGLRVIGFDWFGVL |
| JGI10214J12806_108804743 | 3300000891 | Soil | VKNPPILISVLGFFAGLAGVSFLIFGFRVLGFDWFGIFGDLPEYD |
| JGIcombinedJ13530_1014753162 | 3300001213 | Wetland | VKNPPILISVLGFFAVMAGVYYIFGGLRLVGFDFFGAFKN |
| Ga0031656_101182962 | 3300003858 | Freshwater Lake Sediment | MRNPPILVSVLGFFAGLAGFAWIFLGLRILGFDWFTVLGDV |
| Ga0062589_1017912852 | 3300004156 | Soil | MRNPPILVSVIGFFGAIAGFYWLYLGLRLLGFDWFGALGDLPSTE |
| Ga0062589_1018951212 | 3300004156 | Soil | VRNPPILISVIGFFAALAGFNYLFLGLRALGFDWFNALGD |
| Ga0062590_1020171881 | 3300004157 | Soil | MRNPPILVSVIGFFALLAGFGYLFFGLRVLGFDWFGLFGD |
| Ga0062595_1012094492 | 3300004479 | Soil | MKNPPILISIIGFFAALAGFAYLFFGLRVLGFDWFGILGDLQAFEHV |
| Ga0062591_1001222081 | 3300004643 | Soil | MKNPPVLVAVLGFFAALAGFGFIFMGFRMIGFDWFGLFGD |
| Ga0070692_106784871 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VRNPPILISVLGFFAGLAGFSYLFYGLRMLGFDWFGAFGDLPQLE |
| Ga0070674_1009158822 | 3300005356 | Miscanthus Rhizosphere | VKNPPILISVLGFFAGLAGVSFLFFGLRVLGFDWFGAFGDLPE |
| Ga0070659_1019960702 | 3300005366 | Corn Rhizosphere | MRNPPILISVLGFFAALAGFGWLFFGLRVLGFDWFGIFGDLPQFNSV |
| Ga0070685_111883711 | 3300005466 | Switchgrass Rhizosphere | MKNPPILISVLGFFAALAGFAWLFFGLRLLGFDWFGLFGDVPALEH |
| Ga0070702_1018778971 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNPPILVSVIGFFGAIAGFYWLYLGLRLLGFDWFGALGDLP |
| Ga0074472_111963851 | 3300005833 | Sediment (Intertidal) | MKNPPILISVIGFFAALAGFAGIFFGLRILGFDWFGALGDLPAFESV |
| Ga0068860_1024980782 | 3300005843 | Switchgrass Rhizosphere | MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWF |
| Ga0075417_101942903 | 3300006049 | Populus Rhizosphere | VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGAF |
| Ga0075364_104499081 | 3300006051 | Populus Endosphere | VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGAFG |
| Ga0074048_126404151 | 3300006581 | Soil | MRNPPVLVSVIGFFAALAGFGFLFYGLRVLGFDWFGLLGD |
| Ga0111539_133060152 | 3300009094 | Populus Rhizosphere | VRNPPILVSVIGFFGLLAGFEFFFFALRAIGFDWFGLFGDLPAVE |
| Ga0105247_109802512 | 3300009101 | Switchgrass Rhizosphere | VLNPPILISVLGFFGLLAGFGFFFFGLRAIGFDWFGLFGDLP |
| Ga0105243_126183402 | 3300009148 | Miscanthus Rhizosphere | MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWFG |
| Ga0126307_108837601 | 3300009789 | Serpentine Soil | MRNPPVLISVIGFFAAIAGFAMLFAGLRFLGFDWFGV |
| Ga0126379_131778802 | 3300010366 | Tropical Forest Soil | MKNPPILISVLGFFAGLAGFAWLFFGLRVLGFDWFGIFG |
| Ga0134124_117929132 | 3300010397 | Terrestrial Soil | VRNPPILISVLGFFGLLAGFEFFFFGLRALGFDWFGLFGDLP |
| Ga0134122_130766391 | 3300010400 | Terrestrial Soil | VRNPPVLVSVIGFFAALAGFGFLFWGLRVLGFDWFGAL |
| Ga0134121_125618031 | 3300010401 | Terrestrial Soil | MKNPPILIAVLGFFGLMTAFFYIFAGLRMIGFDWFGAFKD |
| Ga0134123_113525601 | 3300010403 | Terrestrial Soil | VRNPPILISVLGFFAGLAGFSYLFYGLRMLGFDWF |
| Ga0150984_1054415711 | 3300012469 | Avena Fatua Rhizosphere | VRNPPILISVIGFFGAIAGFAWLFFGLRLLGFDWFGAFGDLPQFEHV |
| Ga0157300_10543021 | 3300012884 | Soil | MKNPPILISVLGFFGAMAGFAWLFFGLRLLGFDWFGAL |
| Ga0157287_11028362 | 3300012885 | Soil | MKNPPILVSVLGFFAALAGFGFLFFGLRVICFDWFEMI |
| Ga0157290_104804852 | 3300012909 | Soil | MRNPPVLVSVIGFFAMLAGLYWLYLGLRLLGFDWFGALGDLPAYEQ |
| Ga0164298_105818171 | 3300012955 | Soil | MRNPPILISVLGFFAMLAGFGFFFFGLRVLGFDWFGIFG |
| Ga0164302_117285642 | 3300012961 | Soil | MKNPPILISVLGFFAALAGFAWLFFGLRLLGFDWFGLFGDVP |
| Ga0164308_115420002 | 3300012985 | Soil | MKNPPILISVIGFFALLAGFGFFFFGLRVLGFDWFGIL |
| Ga0164307_103560823 | 3300012987 | Soil | MRNPPILISVIGFFAALAGFGYLFMGFRMLGFDWFGALGDLPAFNHV |
| Ga0164306_114465822 | 3300012988 | Soil | MKNPPILIAVLGFFAALAGFGFLFFGLRAIGFDWFGAFGDLPQL |
| Ga0164305_116607733 | 3300012989 | Soil | MKNPPILISVVGFFAGLAGFGYLFFGLRILGFDWFGIFGDLPSVERV |
| Ga0075327_13288601 | 3300014272 | Natural And Restored Wetlands | MKNPPILISVIGFFAMLAGFGFLFWGFSVIGFDWFGLFGDLPE |
| Ga0075339_12253372 | 3300014316 | Natural And Restored Wetlands | VKNPPILISVIGFFAAMAGFAWLFFGLRLLGFDWFGVLGD |
| Ga0157380_118603891 | 3300014326 | Switchgrass Rhizosphere | MKNPPILISVLGFFAALAGFGFLFYGLRVIGFDWFGIFGDLP |
| Ga0173480_101227451 | 3300015200 | Soil | MKNPPILISVLGFFAALAGFAFFFFGLRVLGFDWFGAL |
| Ga0173480_108287721 | 3300015200 | Soil | MKNPPIFVSLLGFFALLAGFAYLFFGLRMIGFDWFGV |
| Ga0173478_101634281 | 3300015201 | Soil | VKNPPILIAVLGFFGALAGFYWLYLGLRLLGFDWFGL |
| Ga0132258_108746355 | 3300015371 | Arabidopsis Rhizosphere | MRTPPILISVLGFFAALAGFGWLFFGLRVLGFDWFGAL |
| Ga0132258_115729961 | 3300015371 | Arabidopsis Rhizosphere | MKNPPILISVIGFFAAMAGFAWLFLGLRILGFDWFGILGDLPKF |
| Ga0132256_1030425682 | 3300015372 | Arabidopsis Rhizosphere | VRNPPILISVLGFFGLLAGFEFFFFGLRALGFDWFGLFGDLERYEGV |
| Ga0132257_1040252001 | 3300015373 | Arabidopsis Rhizosphere | MKNPPILISILGFFAALAGFGLLFWGFRVLGFDWFGAFG |
| Ga0132255_1043721651 | 3300015374 | Arabidopsis Rhizosphere | MRNPPILISVIGFFAALAGFGFLFYGLRVIGFDWFGALGD |
| Ga0182041_112698971 | 3300016294 | Soil | MRNPPILVAVIGFFAALAGFSFLFFGLRAIGFDWFGA |
| Ga0182033_116924511 | 3300016319 | Soil | MRNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGALGDLPQ |
| Ga0182040_111038722 | 3300016387 | Soil | MRNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGALGDLPQFN |
| Ga0182037_118295282 | 3300016404 | Soil | MRNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGALGDL |
| Ga0187765_100713474 | 3300018060 | Tropical Peatland | VKNPPILIAVLGFFAALAGFGFLFFGLRAIGFDWFGAL |
| Ga0187765_103009652 | 3300018060 | Tropical Peatland | MRNPPIFISVLGFFAAMAGFGYLFWGLRVLGFDWFGAFG |
| Ga0190275_130454722 | 3300018432 | Soil | VKNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGAFGD |
| Ga0190270_108066541 | 3300018469 | Soil | MHVKNPPILVAVLGFFAALAGFGFLFFGLRVLGFDWFGALG |
| Ga0190271_100308167 | 3300018481 | Soil | MKNPPILISVLGFFAALAGFAYFFFGLRVLGFDWFGAFG |
| Ga0190271_104897611 | 3300018481 | Soil | MKNPPILISVLGFFGAMAGFAWLFFGLRLLGFDWFG |
| Ga0173481_106960881 | 3300019356 | Soil | MRNPPILIAVIGFFGALAGMFWLYLGLRLLGFDWFGALGDLPAFE |
| Ga0173479_104228482 | 3300019362 | Soil | VRNPPILVSVIGFFGLLAGFEFFFFGLRAIGFDWFGLFGDL |
| Ga0247783_12258811 | 3300022911 | Plant Litter | VKNPPILIAVLGFFGALAGFYWLYLGLRLLGFDWFGLLGDLQPFEA |
| Ga0247790_101958451 | 3300022915 | Soil | VKNPPILISVLGFFAGLAGVSFLIFGFRVLGFDWFGIFGDLPEYDDVG |
| Ga0247802_10418282 | 3300023077 | Soil | VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGA |
| Ga0207663_102795601 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNPPILISILGFFAALAGFGLLFWGFRVLGFDWFGAFGDLP |
| Ga0207681_101627681 | 3300025923 | Switchgrass Rhizosphere | MRNPPVLVAVLGFFGALAGFGFLFMGFRMLGFDWFGLFGDLPRFE |
| Ga0207694_112602102 | 3300025924 | Corn Rhizosphere | MRNPPVLVAVLGFFGALAGFGFLFMGFRMLGFDWFGLFGDL |
| Ga0207701_101896664 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGALGDLPA |
| Ga0207639_122687241 | 3300026041 | Corn Rhizosphere | VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFG |
| Ga0208654_10115122 | 3300026062 | Natural And Restored Wetlands | MRNPPILVSVIGFFGAIAGFYWIYLGLRLLGFDWFGA |
| Ga0207428_104607121 | 3300027907 | Populus Rhizosphere | MRNPPILVSVIGFFAAIAGFYWIYLGLRIIGFDWFGILGDL |
| Ga0268264_102794813 | 3300028381 | Switchgrass Rhizosphere | VRNPPILISVLGFFGLLAGFGFFFFGLRAIGFDWFGLFGDLPAVEHVGL |
| Ga0247823_109974862 | 3300028590 | Soil | VKNPPILIAVLGFFGALAGFYWLYLGLRLLGFDWFGLLGDLQPF |
| Ga0307316_102495583 | 3300028755 | Soil | VRNPPILISVLGFFGAMAGFAWLFIGLRMIGFDWFGIFGDLPAFERV |
| Ga0307281_100358903 | 3300028803 | Soil | MKNPPILISVLGFFAALAGFGFLFFGLRVIGFDWFG |
| Ga0307281_101391521 | 3300028803 | Soil | MRNPPILVSVIGFFAALAGFGWLLVGLRLLGFDWFGALGD |
| Ga0302295_10335061 | 3300028856 | Fen | MKNPPVLVSVIGFFAAIAGFGWIVLGARPLGFDWFG |
| Ga0307289_100893761 | 3300028875 | Soil | MKNPPILISVLGFFAALAGFGFLFFGLRVIGFDWF |
| Ga0311347_101242521 | 3300029923 | Fen | MKNPPILVSVIGFFAAIAGFAWLAFGLRLLGFDWFGV |
| Ga0302273_10298404 | 3300030048 | Bog | VKNPPILISVLGFFAAMAGFAWLFFGMRLLGFDWFGALGDVPAFEH |
| Ga0302287_102486122 | 3300030673 | Fen | MKNPPVLVSVIGFFAAIAGFGWIVLGARLLGFDWFGVL |
| Ga0308178_10506901 | 3300030990 | Soil | VRNPPILIAVIGFFAAMAGFGWLFMGMRMLGFDWFG |
| Ga0316578_101419171 | 3300031728 | Rhizosphere | MKNPPILISVLGFFVGMAGFAWLFFGISLLGFDWFGALGDL |
| Ga0318550_104540952 | 3300031797 | Soil | MKNPPIFISVLGFFAALAGFGYLFWGLRVLGFDWFGAFGDLPAVEH |
| Ga0315297_114736431 | 3300031873 | Sediment | MRNPPVLVSVIGFFAALAGFGWLLVGLRLVGFDWFGALG |
| Ga0315278_108887453 | 3300031997 | Sediment | VKNPPVLISVIGFFGALAGFGYIFFGLRALGFDWF |
| Ga0306922_118086112 | 3300032001 | Soil | MRNPPILVAVIGFFAALAGFSFLFFGLRAIGFDWFG |
| Ga0310897_104034702 | 3300032003 | Soil | MRNPPVLVAVLGFFGALAGFGFLFMGFRMLGFDWFGLF |
| Ga0318569_104928662 | 3300032010 | Soil | VRNPPILIAVLGFFAGLAGFSFLFFGLRVIGFDWFGVLGDLPK |
| Ga0310906_106885092 | 3300032013 | Soil | MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWFGIFGDLPN |
| Ga0318533_112026112 | 3300032059 | Soil | VRNPPILIAVLGFFAGLAGFSFLFFGLRVIGFDWFGVLGDLPKYE |
| Ga0315292_100515794 | 3300032143 | Sediment | MKNPPILISVIGFFVALAGFAWLFLGLRVLGFDWFT |
| Ga0315292_112976521 | 3300032143 | Sediment | VKNPPILISVIGFFAAMAGFGWLFFGLRLLGFDWFG |
| Ga0310896_106234162 | 3300032211 | Soil | MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWFGIFGD |
| Ga0315270_101165381 | 3300032275 | Sediment | MKNPPVLVSVIGFFVALAGFAWLFLGLRLIGFDWFGILGD |
| Ga0315270_106343452 | 3300032275 | Sediment | MKNPPILISVIGFFAAIAGFAWLFLGLRLLGFDWF |
| Ga0316605_120911252 | 3300033408 | Soil | MKNPPVLISVIGFFAALAGFGWLFFGLRVLGFDWFGLLGDLP |
| Ga0316622_1006801693 | 3300033416 | Soil | MKNPPILVSIIGFFGVLAGLGWLVLGLRILGFDWFTV |
| Ga0326723_0378401_1_129 | 3300034090 | Peat Soil | MKNPPILIAVIGFFAALAGFGYLFFGLRVLGFDWFGLLGDLPA |
| Ga0364935_0119889_702_818 | 3300034151 | Sediment | MRNPPVLVSVIGFFAMLAGLYWLYLGLRLLGFDWFGALG |
| ⦗Top⦘ |