


| Basic Information | |
|---|---|
| Family ID | F099165 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKHGQRLN |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 16.50 % |
| % of genes near scaffold ends (potentially truncated) | 38.83 % |
| % of genes from short scaffolds (< 2000 bps) | 85.44 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.252 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (26.214 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.86% β-sheet: 0.00% Coil/Unstructured: 58.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 53.40 |
| PF14340 | DUF4395 | 30.10 |
| PF01475 | FUR | 5.83 |
| PF08669 | GCV_T_C | 2.91 |
| PF08768 | THAP4_heme-bd | 2.91 |
| PF01571 | GCV_T | 1.94 |
| PF00248 | Aldo_ket_red | 0.97 |
| PF00486 | Trans_reg_C | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 5.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.25 % |
| All Organisms | root | All Organisms | 41.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10233044 | Not Available | 576 | Open in IMG/M |
| 3300005525|Ga0068877_10686106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300005528|Ga0068872_10088218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1869 | Open in IMG/M |
| 3300005528|Ga0068872_10679405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300005565|Ga0068885_1154968 | Not Available | 695 | Open in IMG/M |
| 3300006030|Ga0075470_10053992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1229 | Open in IMG/M |
| 3300006030|Ga0075470_10143578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300006030|Ga0075470_10186496 | Not Available | 597 | Open in IMG/M |
| 3300006030|Ga0075470_10190074 | Not Available | 590 | Open in IMG/M |
| 3300006030|Ga0075470_10223280 | Not Available | 535 | Open in IMG/M |
| 3300006641|Ga0075471_10317617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300006641|Ga0075471_10612780 | Not Available | 533 | Open in IMG/M |
| 3300006863|Ga0075459_1016747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1209 | Open in IMG/M |
| 3300006875|Ga0075473_10274761 | Not Available | 681 | Open in IMG/M |
| 3300006875|Ga0075473_10371290 | Not Available | 578 | Open in IMG/M |
| 3300006875|Ga0075473_10407290 | Not Available | 549 | Open in IMG/M |
| 3300006917|Ga0075472_10435350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300006917|Ga0075472_10490813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300006917|Ga0075472_10515799 | Not Available | 595 | Open in IMG/M |
| 3300007094|Ga0102532_1042316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA028-G02 | 2664 | Open in IMG/M |
| 3300007177|Ga0102978_1058347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1201 | Open in IMG/M |
| 3300007202|Ga0103274_1132360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA044-O16 | 3364 | Open in IMG/M |
| 3300007214|Ga0103959_1218427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
| 3300007363|Ga0075458_10012790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 2676 | Open in IMG/M |
| 3300007363|Ga0075458_10106687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300007548|Ga0102877_1206183 | Not Available | 554 | Open in IMG/M |
| 3300007627|Ga0102869_1159217 | Not Available | 609 | Open in IMG/M |
| 3300008055|Ga0108970_10707280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300008107|Ga0114340_1042321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2948 | Open in IMG/M |
| 3300008108|Ga0114341_10193945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
| 3300008108|Ga0114341_10215830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
| 3300008108|Ga0114341_10387478 | Not Available | 683 | Open in IMG/M |
| 3300008108|Ga0114341_10510741 | Not Available | 541 | Open in IMG/M |
| 3300008108|Ga0114341_10513900 | Not Available | 538 | Open in IMG/M |
| 3300008108|Ga0114341_10516925 | Not Available | 535 | Open in IMG/M |
| 3300008111|Ga0114344_1015902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 4921 | Open in IMG/M |
| 3300008111|Ga0114344_1229342 | Not Available | 558 | Open in IMG/M |
| 3300008114|Ga0114347_1020970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 4987 | Open in IMG/M |
| 3300008262|Ga0114337_1097671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2359 | Open in IMG/M |
| 3300008262|Ga0114337_1187021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300008962|Ga0104242_1061065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300010354|Ga0129333_10152784 | Not Available | 2118 | Open in IMG/M |
| 3300010354|Ga0129333_10321363 | Not Available | 1381 | Open in IMG/M |
| 3300010354|Ga0129333_10870932 | Not Available | 764 | Open in IMG/M |
| 3300010354|Ga0129333_11491488 | Not Available | 554 | Open in IMG/M |
| 3300010370|Ga0129336_10594826 | Not Available | 591 | Open in IMG/M |
| 3300010370|Ga0129336_10744370 | Not Available | 518 | Open in IMG/M |
| 3300012000|Ga0119951_1116286 | Not Available | 618 | Open in IMG/M |
| 3300012006|Ga0119955_1108748 | Not Available | 771 | Open in IMG/M |
| 3300012968|Ga0129337_1386811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
| 3300012970|Ga0129338_1004293 | Not Available | 705 | Open in IMG/M |
| 3300014801|Ga0119946_1004963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
| 3300020499|Ga0208084_1001166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5175 | Open in IMG/M |
| 3300020516|Ga0207935_1000515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9364 | Open in IMG/M |
| 3300020551|Ga0208360_1037543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300022752|Ga0214917_10106711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1611 | Open in IMG/M |
| 3300022752|Ga0214917_10179481 | Not Available | 1073 | Open in IMG/M |
| 3300024289|Ga0255147_1053830 | Not Available | 778 | Open in IMG/M |
| 3300024306|Ga0255148_1060478 | Not Available | 662 | Open in IMG/M |
| 3300024351|Ga0255141_1031946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300024481|Ga0256330_1139441 | Not Available | 512 | Open in IMG/M |
| 3300024491|Ga0255203_1050484 | Not Available | 539 | Open in IMG/M |
| 3300024492|Ga0255189_1018350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300024494|Ga0255194_1045947 | Not Available | 631 | Open in IMG/M |
| 3300024503|Ga0255152_1048732 | Not Available | 757 | Open in IMG/M |
| 3300024513|Ga0255144_1021596 | Not Available | 1112 | Open in IMG/M |
| 3300024513|Ga0255144_1061954 | Not Available | 623 | Open in IMG/M |
| 3300024857|Ga0256339_1019984 | Not Available | 1440 | Open in IMG/M |
| 3300024864|Ga0255271_1062236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300024865|Ga0256340_1123677 | Not Available | 625 | Open in IMG/M |
| 3300024865|Ga0256340_1146353 | Not Available | 567 | Open in IMG/M |
| 3300025585|Ga0208546_1042971 | Not Available | 1089 | Open in IMG/M |
| 3300025585|Ga0208546_1086295 | Not Available | 713 | Open in IMG/M |
| 3300025585|Ga0208546_1123653 | Not Available | 566 | Open in IMG/M |
| 3300025635|Ga0208147_1021919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1713 | Open in IMG/M |
| 3300025635|Ga0208147_1048691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300025635|Ga0208147_1104501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300025732|Ga0208784_1038587 | Not Available | 1497 | Open in IMG/M |
| 3300025732|Ga0208784_1049335 | Not Available | 1300 | Open in IMG/M |
| 3300025848|Ga0208005_1015405 | Not Available | 2337 | Open in IMG/M |
| 3300026455|Ga0255155_1016573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1342 | Open in IMG/M |
| 3300026478|Ga0255156_1004872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2798 | Open in IMG/M |
| 3300027079|Ga0255188_1029344 | Not Available | 1117 | Open in IMG/M |
| 3300027135|Ga0255073_1054439 | Not Available | 651 | Open in IMG/M |
| 3300027804|Ga0209358_10268537 | Not Available | 851 | Open in IMG/M |
| 3300027816|Ga0209990_10038020 | Not Available | 2531 | Open in IMG/M |
| 3300028066|Ga0255200_1030031 | Not Available | 845 | Open in IMG/M |
| 3300028067|Ga0255192_1026723 | Not Available | 866 | Open in IMG/M |
| 3300028083|Ga0255190_1031633 | Not Available | 847 | Open in IMG/M |
| 3300028086|Ga0255201_1015892 | Not Available | 1273 | Open in IMG/M |
| 3300029933|Ga0119945_1001013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 4222 | Open in IMG/M |
| 3300031758|Ga0315907_10608499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila vernalis | 846 | Open in IMG/M |
| 3300031787|Ga0315900_10745914 | Not Available | 684 | Open in IMG/M |
| 3300031787|Ga0315900_11084118 | Not Available | 517 | Open in IMG/M |
| 3300031951|Ga0315904_11400219 | Not Available | 522 | Open in IMG/M |
| 3300031951|Ga0315904_11434476 | Not Available | 513 | Open in IMG/M |
| 3300032050|Ga0315906_11008328 | Not Available | 625 | Open in IMG/M |
| 3300032092|Ga0315905_10622908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| 3300032092|Ga0315905_11622779 | Not Available | 501 | Open in IMG/M |
| 3300032093|Ga0315902_11047032 | Not Available | 607 | Open in IMG/M |
| 3300032116|Ga0315903_11114014 | Not Available | 541 | Open in IMG/M |
| 3300033994|Ga0334996_0074819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 2030 | Open in IMG/M |
| 3300034112|Ga0335066_0396728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 754 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 26.21% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 21.36% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.83% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.94% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.97% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.97% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007202 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300020499 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024491 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300024492 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300024494 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027079 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028066 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300028067 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_102330442 | 3300000882 | Freshwater And Marine | LDIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGHRLN* |
| Ga0068877_106861062 | 3300005525 | Freshwater Lake | LSSWIFLNQQLRKTELTSETAEINHASLCEELGLDAEHGKR |
| Ga0068872_100882182 | 3300005528 | Freshwater Lake | MVEDQQLRTTELTSETAEINYTPLCEELGLDTKHGPRLS* |
| Ga0068872_106794052 | 3300005528 | Freshwater Lake | LSSWIFLNQQLRKTELTSETAEINHASLCEELGLDAEHG |
| Ga0068885_11549682 | 3300005565 | Freshwater Lake | LGSWILLNQQLRKTELTSETAEINHTPLCEELGLDAEHGQRLN* |
| Ga0075470_100539923 | 3300006030 | Aqueous | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHG* |
| Ga0075470_101435782 | 3300006030 | Aqueous | MGSWTVKNQQLRKTELASETAEINHAPLCEEPGLNAKHGQRLN* |
| Ga0075470_101864961 | 3300006030 | Aqueous | MGSSIVKNQQLRKTELASKAAEINHTPLCEELGLDAKHEQRLN* |
| Ga0075470_101900742 | 3300006030 | Aqueous | GSWTVKNQQLRKTELASETAEINHAPLCEELGLDAKHGQRLN* |
| Ga0075470_102232801 | 3300006030 | Aqueous | KSLMGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKHGERLN* |
| Ga0075471_103176172 | 3300006641 | Aqueous | MVEDQQLRTTELTSETAEINYTPLCEVLGLDTKHGPRLS* |
| Ga0075471_106127801 | 3300006641 | Aqueous | KNQQLRKTELASKAAEINHTPLCEELGLDAKHEQRLN* |
| Ga0075459_10167473 | 3300006863 | Aqueous | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGQRLN* |
| Ga0075473_102747611 | 3300006875 | Aqueous | SVALNFKTLVIDIYFLLSKFLMGSWTVKNQQLRKTELASKAAEINHTPLCEELGLDAKHEQRLN* |
| Ga0075473_103712902 | 3300006875 | Aqueous | SVALNFKTLVIDIYFLLSKFLMGSWTVKNQQLRKTELASKTAEINHAPLCEELGLNAKHGQRLN* |
| Ga0075473_104072902 | 3300006875 | Aqueous | MGSWTVKNQQLRKTELASETAEINHAPLCEELGLDAKHGQRLN* |
| Ga0075472_104353502 | 3300006917 | Aqueous | LGSWIFLNQQLRKTELTSETAEINHAPLCEELGLNAEHGHRLN* |
| Ga0075472_104908132 | 3300006917 | Aqueous | LDSKNQQLRKTELASEAAEINHAPLCEELGLDAKHGQRLN* |
| Ga0075472_105157992 | 3300006917 | Aqueous | MGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKHEQRLN* |
| Ga0102532_10423166 | 3300007094 | Freshwater Lake | LGSWIFLNQQLRQTELTSETAEINHTPLCEELGLDAEHGHRLN* |
| Ga0102978_10583473 | 3300007177 | Freshwater Lake | LGSWIFLNQQLRKTELTSETAEINHAPLCEELGLDAEHGHRLN* |
| Ga0103274_11323607 | 3300007202 | Freshwater Lake | LGSWIFLNQQLRKTELTSETAEINHAPLCEELGLDAEHGQRLN* |
| Ga0103959_12184272 | 3300007214 | Freshwater Lake | LGSWIFLNQQLRQTELTSETAEINHAPLCEELGLDAEHDQRLN* |
| Ga0075458_100127905 | 3300007363 | Aqueous | MVEDQQLRTTELTSETAEINDTPLCEELGLDAKHDPRLS* |
| Ga0075458_101066872 | 3300007363 | Aqueous | MGSWTVKNQQLRKTELASKTAEINHAPLCEELGLNAKHGQRLN* |
| Ga0102877_12061832 | 3300007548 | Estuarine | LGSWIFLNQQLRKTELTGETAEINHAPLCEELGLDAEHGHRLN* |
| Ga0102869_11592172 | 3300007627 | Estuarine | MVKDQQLRTTELTSETAEINYTPLCEELGLDTKHGPRLS* |
| Ga0108970_107072801 | 3300008055 | Estuary | MGSWTVKNQQLRKTELASETAEINYAPLCEELGLDAKHGQRLN* |
| Ga0114340_10423216 | 3300008107 | Freshwater, Plankton | MVEDQQLRKTELTSETAEINHTPLCEELGLDAEHGQRLN* |
| Ga0114341_101939452 | 3300008108 | Freshwater, Plankton | MGSWTVKNQQLRKTELASKTAEINHAPLCEELGLDAKHGQRLN* |
| Ga0114341_102158302 | 3300008108 | Freshwater, Plankton | MGSWTVKNQQLRKTELAREATEINHTSLCEELGLDAKHGQRLN* |
| Ga0114341_103874782 | 3300008108 | Freshwater, Plankton | MGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKHGQRLN* |
| Ga0114341_105107411 | 3300008108 | Freshwater, Plankton | SWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGQRLN* |
| Ga0114341_105139002 | 3300008108 | Freshwater, Plankton | GSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGQRLN* |
| Ga0114341_105169251 | 3300008108 | Freshwater, Plankton | SWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGHRLN* |
| Ga0114344_10159023 | 3300008111 | Freshwater, Plankton | MVEDQQLRTTELTSETAEINYTPLCEELGLDAKHGPRLS* |
| Ga0114344_12293421 | 3300008111 | Freshwater, Plankton | GSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGHRLN* |
| Ga0114347_10209708 | 3300008114 | Freshwater, Plankton | LGSWIFLNQQLRKTELTSETAEINHTPLCEEMGLDAEHGQRLN* |
| Ga0114337_10976715 | 3300008262 | Freshwater, Plankton | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGLN* |
| Ga0114337_11870212 | 3300008262 | Freshwater, Plankton | MGSWTVKNQQLRKTELASKAAEINHTPLCEELGLDAKHGQRLN* |
| Ga0104242_10610652 | 3300008962 | Freshwater | MEINQQLRKTELASETAEINHTPLCEELGLDAKHRQRLN* |
| Ga0129333_101527844 | 3300010354 | Freshwater To Marine Saline Gradient | MVKDQQLRTTELTSETAEINYTPLCEELGLDAKHGPRLS* |
| Ga0129333_103213633 | 3300010354 | Freshwater To Marine Saline Gradient | WGCSNQQLRKTELASKTAEINHTPLGKELGLDEEHGLRID* |
| Ga0129333_108709322 | 3300010354 | Freshwater To Marine Saline Gradient | LDSNNQQLRKTELASEAAEINYAPLCEKLGLNAKHGQRLN* |
| Ga0129333_114914881 | 3300010354 | Freshwater To Marine Saline Gradient | FSRKLGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDTEHGYRLN* |
| Ga0129336_105948262 | 3300010370 | Freshwater To Marine Saline Gradient | LLSKFLMGSWTVKNQQLRKTELASETAEINHTPLCEELGLDTKHEQRLN* |
| Ga0129336_107443702 | 3300010370 | Freshwater To Marine Saline Gradient | MVEDQQLRTTELTSETAEINDTPLCEELGLDAKHGPRLS* |
| Ga0119951_11162862 | 3300012000 | Freshwater | MEINQQLRKTELASETAEINHAPLCEELGLYAEHGE |
| Ga0119955_11087482 | 3300012006 | Freshwater | LELLDQQLRTTELASETAEINHAPFCEELEPDAKHGRKNKRNPVM |
| Ga0129337_13868113 | 3300012968 | Aqueous | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGHRLN* |
| Ga0129338_10042932 | 3300012970 | Aqueous | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLNAKHGQRLN* |
| Ga0119946_10049633 | 3300014801 | Aquatic | LELLDQQLRTTELASETAEINHTPLCEELEPDAKHG* |
| Ga0208084_10011668 | 3300020499 | Freshwater | LGSWIFLNQQLRKTELTSETAEINHTPLCEEMGLDAEHGQRLN |
| Ga0207935_100051513 | 3300020516 | Freshwater | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGQRLN |
| Ga0208360_10375432 | 3300020551 | Freshwater | MVEDQQLRTTELTSETAEINYTPLCEELGLDAEHGQRLN |
| Ga0214917_101067112 | 3300022752 | Freshwater | LDLKNQQLRTTELASETAEINHTPLCEELEPDAKHGVKSKRIKSL |
| Ga0214917_101794813 | 3300022752 | Freshwater | MGSWTVKNQQLRKTELASETAEINHTSLCEELGLDAKHWQRLN |
| Ga0255147_10538302 | 3300024289 | Freshwater | MVEDQQLRTTELTSETAEINDTPLCEELGLDAKHGPRLS |
| Ga0255148_10604782 | 3300024306 | Freshwater | MVEDQQLRTTELTSETAEINDTPLCEELGLDAKHGPR |
| Ga0255141_10319462 | 3300024351 | Freshwater | MDIYFLPSRFLMGSWTVKNQQLRKTELASETAEINHAPLCEELGLDAKHEQRLN |
| Ga0256330_11394411 | 3300024481 | Freshwater | LDLKNQQLRTTELASETAEINHTPLCEELEPDAKHG |
| Ga0255203_10504842 | 3300024491 | Freshwater | LGSWIFLNQQLRKTELTSETAEINHAPLCEELGLDAEHG |
| Ga0255189_10183501 | 3300024492 | Freshwater | LGSWTVKNQQLRKTELASKTAEINHAPLCEELGLDAKH |
| Ga0255194_10459472 | 3300024494 | Freshwater | DIYFLPSRFLMGSWTVKNQQLRKTELASKTAEINHAPLCEELGLDAKHGQRLN |
| Ga0255152_10487321 | 3300024503 | Freshwater | KILVIDIYFLLSKFLMGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKHGQRLN |
| Ga0255144_10215963 | 3300024513 | Freshwater | IDIYYLLSKFLMGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKHGQRLN |
| Ga0255144_10619541 | 3300024513 | Freshwater | MGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKH |
| Ga0256339_10199841 | 3300024857 | Freshwater | MDIYFLPSRFLMGSWTVKNQQLRKTELASETAEINHAPLC |
| Ga0255271_10622362 | 3300024864 | Freshwater | MVEDQQLRTTELTSETAEINDTPLCEELGLDAEHGHRLN |
| Ga0256340_11236771 | 3300024865 | Freshwater | MDIYFLPSRFLMGSWTVKNQQLRKTELASETAEINHAPLCEELG |
| Ga0256340_11463532 | 3300024865 | Freshwater | GSWTVKNQQLRKTELASETAEINHASLCEELGFDAKHRQRLN |
| Ga0208546_10429713 | 3300025585 | Aqueous | NFKTLVIDIYFLPSRFLMGSWTGKNQQLRKTELASKTAEINHAPLCEELGLDAKHGHRLN |
| Ga0208546_10862952 | 3300025585 | Aqueous | LDSKNQQLRKTELASKAAEINHTPLCEELGLDAKHEQRLN |
| Ga0208546_11236532 | 3300025585 | Aqueous | MDIYFLPSRFLMGSWTVKNQQLRKTELASKTAEINHAPLCEELGLNAKHEQRLN |
| Ga0208147_10219192 | 3300025635 | Aqueous | MVEDQQLRTTELTSETAEINDTPLCEELGLDAKHDPRLS |
| Ga0208147_10486911 | 3300025635 | Aqueous | LEENQQLCTTELASETAEINHTPLCEELEPDTKHER |
| Ga0208147_11045012 | 3300025635 | Aqueous | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHG |
| Ga0208784_10385874 | 3300025732 | Aqueous | MGSWTVKNQQLRKTELASETAEINHAPLCEEPGLNAKHGQRLN |
| Ga0208784_10493352 | 3300025732 | Aqueous | MGSWTVKNQQLRKTELASETAEINHAPLCEELGLDAKHGQRLN |
| Ga0208005_10154052 | 3300025848 | Aqueous | MVEDQQLRTTELTSETAEINYTPLCEVLGLDTKHGPRLS |
| Ga0255155_10165732 | 3300026455 | Freshwater | MVENQQLRTTELTSETAEINHAPLCEELGLDAKHGQRLN |
| Ga0255156_10048723 | 3300026478 | Freshwater | MGSWTVKNQQLRKTELASKAAEINHTPLCEELALDAKHEQRLN |
| Ga0255188_10293441 | 3300027079 | Freshwater | MGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAKHEQRLN |
| Ga0255073_10544392 | 3300027135 | Freshwater | SVGSWIVEDQQLRTTELTSETAEINYTPLCEELGLDAKHGPRLS |
| Ga0209358_102685373 | 3300027804 | Freshwater Lake | DIYFLLSKFLMGSWTVKNQQLRKTELASETAEINHAPLCEELGLDAKHGQRLN |
| Ga0209990_100380205 | 3300027816 | Freshwater Lake | FLNQQLRKTELTSETAEINHTPLCEELGLDAEHGYRLN |
| Ga0255200_10300312 | 3300028066 | Freshwater | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDTEHG |
| Ga0255192_10267231 | 3300028067 | Freshwater | SRKLGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHG |
| Ga0255190_10316331 | 3300028083 | Freshwater | LLSKFLMGSWTVKNQQLRKTELASKTAEINYAPLCEELGLNSKHGQRLN |
| Ga0255201_10158921 | 3300028086 | Freshwater | FKTLVIDIYYLLSKFLMGSWTVKNQQLRKTELASETAEINHTPLCEELGLDAEHG |
| Ga0119945_10010134 | 3300029933 | Aquatic | LGSWIFLNQQLRKTELTSETAEINHAPLCEELGLDAEHGHRLN |
| Ga0315907_106084991 | 3300031758 | Freshwater | LGSWIFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGKRLS |
| Ga0315900_107459142 | 3300031787 | Freshwater | LSSWIFLNQQLRKTELTSETAEINHASLCEELGLDAEHGKRLS |
| Ga0315900_110841182 | 3300031787 | Freshwater | LGSWIFLIQQLRKTELTSETAEINHTPLCEELGIDAEHGQRLN |
| Ga0315904_114002192 | 3300031951 | Freshwater | KNQQLRKTELASKTAEINHAPLCEELGLNAKHGQRLN |
| Ga0315904_114344761 | 3300031951 | Freshwater | MGSWTVKNQQLRKTELASKTAEINHAPLCEELGLNAKHGQRLN |
| Ga0315906_110083281 | 3300032050 | Freshwater | LGSWIFLNQQLRKTELTSETAEINHASLCEELGLDAEHGKRLS |
| Ga0315905_106229081 | 3300032092 | Freshwater | IFLNQQLRKTELTSETAEINHTPLCEELGLDAEHGQRLN |
| Ga0315905_116227792 | 3300032092 | Freshwater | IYFLLSKNLMGSWTVKNQQLRKTELASETAEINHAPLCEELGLDAKHGQRLN |
| Ga0315902_110470322 | 3300032093 | Freshwater | LGSWTVKNQQLRKTELASKTAEINHAPLCEELGLDAKHGQRLN |
| Ga0315903_111140142 | 3300032116 | Freshwater | LGSWIFLNQQLRKTELTSETAEINHAPLCEELGLDAEHGQRLN |
| Ga0334996_0074819_363_479 | 3300033994 | Freshwater | VEDQQLRTTELTSETAEINYTPLCEELGLDTKHGPRLS |
| Ga0335066_0396728_641_754 | 3300034112 | Freshwater | LNQQLRKTELTSETAEINHTPLCEELGLDAEHGKRLS |
| ⦗Top⦘ |