


| Basic Information | |
|---|---|
| Family ID | F099036 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PSVEAKGPQEEDMQNSALAPYLQRVEASASTDWSESAAEPKH |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 98.06 % |
| % of genes from short scaffolds (< 2000 bps) | 87.38 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.903 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.631 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 0.00% Coil/Unstructured: 74.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 18.45 |
| PF13467 | RHH_4 | 6.80 |
| PF13586 | DDE_Tnp_1_2 | 1.94 |
| PF03401 | TctC | 0.97 |
| PF00436 | SSB | 0.97 |
| PF04780 | DUF629 | 0.97 |
| PF00891 | Methyltransf_2 | 0.97 |
| PF03330 | DPBB_1 | 0.97 |
| PF07690 | MFS_1 | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF13767 | DUF4168 | 0.97 |
| PF04909 | Amidohydro_2 | 0.97 |
| PF13560 | HTH_31 | 0.97 |
| PF01035 | DNA_binding_1 | 0.97 |
| PF13683 | rve_3 | 0.97 |
| PF04519 | Bactofilin | 0.97 |
| PF02738 | MoCoBD_1 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.97 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.97 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.97 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.97 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.97 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.90 % |
| Unclassified | root | N/A | 30.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_F5ZO29U01AHJRJ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 2170459024|GZTSFBX01AMNI1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1006892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1610 | Open in IMG/M |
| 3300000956|JGI10216J12902_103412440 | Not Available | 522 | Open in IMG/M |
| 3300002906|JGI25614J43888_10191663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300005332|Ga0066388_106697837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300005445|Ga0070708_100083030 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
| 3300005447|Ga0066689_10231946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
| 3300005467|Ga0070706_102102898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300005471|Ga0070698_102151431 | Not Available | 511 | Open in IMG/M |
| 3300005553|Ga0066695_10422774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300005713|Ga0066905_101788974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300005764|Ga0066903_105245098 | Not Available | 685 | Open in IMG/M |
| 3300006032|Ga0066696_10836978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300006794|Ga0066658_10408036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300006853|Ga0075420_101633576 | Not Available | 552 | Open in IMG/M |
| 3300010047|Ga0126382_11973393 | Not Available | 554 | Open in IMG/M |
| 3300010301|Ga0134070_10302359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300010301|Ga0134070_10428136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300010359|Ga0126376_11620841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300010360|Ga0126372_12306374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300010361|Ga0126378_10465385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1379 | Open in IMG/M |
| 3300010376|Ga0126381_101791401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 886 | Open in IMG/M |
| 3300010376|Ga0126381_101906517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300010398|Ga0126383_10840436 | Not Available | 1002 | Open in IMG/M |
| 3300012204|Ga0137374_10227707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1582 | Open in IMG/M |
| 3300012205|Ga0137362_11514762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300012209|Ga0137379_10146663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2267 | Open in IMG/M |
| 3300012211|Ga0137377_10930221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300012211|Ga0137377_11177229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300012350|Ga0137372_10450847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
| 3300012350|Ga0137372_10464760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300012353|Ga0137367_10244768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1290 | Open in IMG/M |
| 3300012353|Ga0137367_10716591 | Not Available | 696 | Open in IMG/M |
| 3300012355|Ga0137369_10518806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300012356|Ga0137371_10491395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300012582|Ga0137358_10484300 | Not Available | 834 | Open in IMG/M |
| 3300012923|Ga0137359_10705321 | Not Available | 879 | Open in IMG/M |
| 3300012948|Ga0126375_10771185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300012948|Ga0126375_11881963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300012971|Ga0126369_11562946 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300012971|Ga0126369_11679329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300012971|Ga0126369_13010910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300016270|Ga0182036_11605968 | Not Available | 548 | Open in IMG/M |
| 3300016319|Ga0182033_10758187 | Not Available | 853 | Open in IMG/M |
| 3300016341|Ga0182035_11747130 | Not Available | 563 | Open in IMG/M |
| 3300016357|Ga0182032_11498106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300016357|Ga0182032_11666497 | Not Available | 556 | Open in IMG/M |
| 3300016371|Ga0182034_10781265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300016371|Ga0182034_11412095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300016445|Ga0182038_10099089 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300017657|Ga0134074_1283298 | Not Available | 601 | Open in IMG/M |
| 3300018027|Ga0184605_10352990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300018433|Ga0066667_10452216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1049 | Open in IMG/M |
| 3300020579|Ga0210407_10222333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1469 | Open in IMG/M |
| 3300021560|Ga0126371_12912823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300025916|Ga0207663_11092514 | Not Available | 641 | Open in IMG/M |
| 3300025922|Ga0207646_10565097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1022 | Open in IMG/M |
| 3300025928|Ga0207700_11291802 | Not Available | 650 | Open in IMG/M |
| 3300025939|Ga0207665_10284269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1232 | Open in IMG/M |
| 3300026306|Ga0209468_1068370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300026310|Ga0209239_1135190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300028878|Ga0307278_10213536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300028878|Ga0307278_10456302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300031545|Ga0318541_10474794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300031573|Ga0310915_10722226 | Not Available | 703 | Open in IMG/M |
| 3300031668|Ga0318542_10092655 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300031713|Ga0318496_10074398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1793 | Open in IMG/M |
| 3300031719|Ga0306917_10879327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300031724|Ga0318500_10145540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1111 | Open in IMG/M |
| 3300031736|Ga0318501_10028742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2435 | Open in IMG/M |
| 3300031736|Ga0318501_10176022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1111 | Open in IMG/M |
| 3300031744|Ga0306918_11057886 | Not Available | 629 | Open in IMG/M |
| 3300031777|Ga0318543_10563537 | Not Available | 510 | Open in IMG/M |
| 3300031778|Ga0318498_10557055 | Not Available | 503 | Open in IMG/M |
| 3300031779|Ga0318566_10424605 | Not Available | 653 | Open in IMG/M |
| 3300031781|Ga0318547_10650335 | Not Available | 654 | Open in IMG/M |
| 3300031782|Ga0318552_10000741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10492 | Open in IMG/M |
| 3300031782|Ga0318552_10323732 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031796|Ga0318576_10026951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2343 | Open in IMG/M |
| 3300031796|Ga0318576_10321016 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031833|Ga0310917_10205814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1316 | Open in IMG/M |
| 3300031835|Ga0318517_10323043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300031845|Ga0318511_10618672 | Not Available | 506 | Open in IMG/M |
| 3300031846|Ga0318512_10027920 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300031879|Ga0306919_10119052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1887 | Open in IMG/M |
| 3300031879|Ga0306919_10535063 | Not Available | 904 | Open in IMG/M |
| 3300031880|Ga0318544_10019153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2277 | Open in IMG/M |
| 3300031890|Ga0306925_10978796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300031910|Ga0306923_10750515 | Not Available | 1082 | Open in IMG/M |
| 3300031946|Ga0310910_11332326 | Not Available | 554 | Open in IMG/M |
| 3300031947|Ga0310909_10002294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11709 | Open in IMG/M |
| 3300031947|Ga0310909_10799840 | Not Available | 779 | Open in IMG/M |
| 3300031954|Ga0306926_10091706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3713 | Open in IMG/M |
| 3300031954|Ga0306926_10191764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2536 | Open in IMG/M |
| 3300032025|Ga0318507_10124947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1088 | Open in IMG/M |
| 3300032035|Ga0310911_10612660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300032064|Ga0318510_10337546 | Not Available | 633 | Open in IMG/M |
| 3300032066|Ga0318514_10523170 | Not Available | 631 | Open in IMG/M |
| 3300032068|Ga0318553_10514297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300032091|Ga0318577_10023213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2604 | Open in IMG/M |
| 3300032261|Ga0306920_102661145 | Not Available | 684 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_4499060 | 2040502001 | Soil | LSIDAKGPEKEDMQSSALAPYLQRVEGSASTDWSE |
| FD1_03645600 | 2170459024 | Grass Soil | KGPPEEDTQSSALAPYMRRVEPSAATDWSESKVEPKH |
| AP72_2010_repI_A100DRAFT_10068921 | 3300000837 | Forest Soil | AKGPQQEDMQNSALAPYLQRVEASASTEWSESAAEPKH* |
| JGI10216J12902_1034124401 | 3300000956 | Soil | VDAKGPQEEDLQSSALAPYLHRAEASASTNWSESTAEPKH* |
| JGI25614J43888_101916633 | 3300002906 | Grasslands Soil | TDLPSVEAKGPQEQEEDMQNSALAPYLQRVEAPASTDWSESAAEPKH* |
| Ga0066388_1066978371 | 3300005332 | Tropical Forest Soil | RVENPTDQPSIHANGPQEEDMPSSALAPYLHRVEPSASTEWSESTVEPKH* |
| Ga0070708_1000830301 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GSQEEDMQNSALAPYLQRVEAPASTDWSESTIEPKHAEL* |
| Ga0066689_102319462 | 3300005447 | Soil | PSVEAKGPQEEDMQNSALAPYLQRVEAPASTDWSESAAEPKH* |
| Ga0070706_1021028981 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LVEAKGPQEEDIQNSALAPYLQRVEASASTDWPESAAEPNH* |
| Ga0070698_1021514312 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAKGSQEEDMQNSALAPYLQRVEAPASTDWSESTIEPKHAEL* |
| Ga0066695_104227741 | 3300005553 | Soil | PQEEDMQNSALAPYLQRVEASASTDLSESAAEPKH* |
| Ga0066905_1017889741 | 3300005713 | Tropical Forest Soil | NPTDLPAVDAKGPQEEDMRGSALAPYLQRAEASASTEWSESTAEPKH* |
| Ga0066903_1052450981 | 3300005764 | Tropical Forest Soil | NPTDLPSVEAKGPQEEAMQNSALAPYLQRVEASASTDWSESAAEPKH* |
| Ga0066696_108369781 | 3300006032 | Soil | AKGPEKEDKQSSALSPYMQRVEEPASTEWSESAIEPKH* |
| Ga0066658_104080361 | 3300006794 | Soil | KGPQETDMRSSALAPYLQRAEASGSPDWSESAVEPKH* |
| Ga0075420_1016335761 | 3300006853 | Populus Rhizosphere | PPVDAKGPRDEDMQSSALAPYLQRVEPSASSEWSESTVEPKH* |
| Ga0126382_119733931 | 3300010047 | Tropical Forest Soil | ENPTDLPSVEAKGPQQEDMQNSALAPYLQRVEASASTEWSESAAEPKH* |
| Ga0134070_103023592 | 3300010301 | Grasslands Soil | KGPQEEDMQNSALAPYLQRVEAPASTDWSESAAEPKH* |
| Ga0134070_104281361 | 3300010301 | Grasslands Soil | VENPTDELLVDAKGPQETDMRSSALAPYLQRAEASGSPDWSESAIEPKH* |
| Ga0126376_116208412 | 3300010359 | Tropical Forest Soil | EQPSIDAKGAREEDMQSSALAPYLHRVEPSASTEWSESTVEPKH* |
| Ga0126372_123063741 | 3300010360 | Tropical Forest Soil | ENPTDAPLVDAKGPQDADMRSSALAPYLQTVEASESPDWSEPKH* |
| Ga0126378_104653853 | 3300010361 | Tropical Forest Soil | DLPSVEAKGPQEEAMQNSALAPYLQRVEASASTEWSESAAQPKH* |
| Ga0126381_1017914011 | 3300010376 | Tropical Forest Soil | RRVENPTDQPSVGAKGPQEEDMQGSALASYLHRVEPSASTDWSESTVEPKH* |
| Ga0126381_1019065171 | 3300010376 | Tropical Forest Soil | PTDSPSVDAKGPQEDLQTSALAPYLRQAPAAADWSEATAEPKH* |
| Ga0126383_108404363 | 3300010398 | Tropical Forest Soil | ENPTDLPSVEAKGPQEEAMQNSALAPYLQRVEASASTDWSESAAEPKH* |
| Ga0137374_102277071 | 3300012204 | Vadose Zone Soil | PTDAPSVDAKGPRDEDMQSSALAPYLQRVEPSASPEWSESTVEPKH* |
| Ga0137362_115147622 | 3300012205 | Vadose Zone Soil | TDLPSVEAKGPQEEDMQNSALAPYLQRVEAPASTDWSESAAEPKH* |
| Ga0137379_101466633 | 3300012209 | Vadose Zone Soil | VDAKGPQEEDMRSSALAPYLQRAEASASTDWSESTAEPKH* |
| Ga0137377_109302211 | 3300012211 | Vadose Zone Soil | EPLVDAKGPQETDMRSSALAPYLQRAEASGSPDWSESAVEPKH* |
| Ga0137377_111772292 | 3300012211 | Vadose Zone Soil | VDAKGPRDEDVRSSALAPYLQRGEPSASTEWSDSTVEPKH* |
| Ga0137372_104508471 | 3300012350 | Vadose Zone Soil | RVENPTDAPSVDAKGPRDEDMQSSALAPYLQRVEPSASSEWSESTVEPKH* |
| Ga0137372_104647602 | 3300012350 | Vadose Zone Soil | AKGPQEEDMRSSALAPYLQRVEASASTEWSESTAEPKH* |
| Ga0137367_102447681 | 3300012353 | Vadose Zone Soil | AKGSRDEEMQSSALAPYLQRAEGSASTEWSESTVEPKH* |
| Ga0137367_107165912 | 3300012353 | Vadose Zone Soil | SVDAKGPRDEDVRSSALAPYLQRVEPSASSEWSESAVEPQH* |
| Ga0137369_105188062 | 3300012355 | Vadose Zone Soil | ENPTDAPSVDAKGPRDENMQSSALAPYLQRVEPSASSEWSESAVEPKH* |
| Ga0137371_104913951 | 3300012356 | Vadose Zone Soil | PSVEAKGPQEEDMQNSALAPYLQRVEASASTDWSESAAEPKH* |
| Ga0137358_104843001 | 3300012582 | Vadose Zone Soil | GPKKEDMQSSVLAPYLQRVEEPGSTEWSDSAVEPKH* |
| Ga0137359_107053211 | 3300012923 | Vadose Zone Soil | AKGPKKEDMQSSVLAPYLQRVEEPGSTEWSDSAVEPKH* |
| Ga0126375_107711852 | 3300012948 | Tropical Forest Soil | VENPTDLPSVEAKGPQQEDMQNSVLAPYLQRVEASASTDWSESAAEPNH* |
| Ga0126375_118819632 | 3300012948 | Tropical Forest Soil | KGPEKEDMQGSALAPYLERVKESASTEWSESTVESKY* |
| Ga0126369_115629462 | 3300012971 | Tropical Forest Soil | DQPSVGAKGPQEEDVQSSALASYLQRVETSASTDWSESTVEPKH* |
| Ga0126369_116793292 | 3300012971 | Tropical Forest Soil | VENPTEQPPIDAKGAREEDVQSSALAPYLHRVEPSASTEWSESTVEPKH* |
| Ga0126369_130109101 | 3300012971 | Tropical Forest Soil | SVEAKGPQEEDMQNSALAPYLQRVEASASTDWPESAAEPKH* |
| Ga0182036_116059682 | 3300016270 | Soil | PSVEAKGPQEEDMQNSALAPYLQRDEASASSDWSESAAEPKH |
| Ga0182033_107581874 | 3300016319 | Soil | DAPSVDDKGPQEEDIQSSALAPYLHRVEASASTEWSESTVEPRH |
| Ga0182035_117471301 | 3300016341 | Soil | GPQEEDMQNSALAPYLQRVEAPASADWSESAAEPKH |
| Ga0182032_100078827 | 3300016357 | Soil | RRVENPMDLSSPADAKRSQKVDRENSALAPYLQRVEDSASTEWSEATVEPKH |
| Ga0182032_114981061 | 3300016357 | Soil | NPMDAPSIDAKGPQEEDVRSSALAPYLQRVEASGSTDWSESTVEPKH |
| Ga0182032_116664971 | 3300016357 | Soil | TDLPSVEAKGPQEEDIQNSALAPYLQRDEASASSDWSESAAEPKH |
| Ga0182034_107812652 | 3300016371 | Soil | VENPTDLPSVEAKGPQEEDMQNSALAPYLQRVEASASTDWA |
| Ga0182034_114120951 | 3300016371 | Soil | QPSAGAKGPQEEDMQGSALASYLHRVEPSASTDWSESTVEPKH |
| Ga0182038_100990891 | 3300016445 | Soil | KGPQEEDVQSSALASYLQRVEASASTDWSESTVEPKH |
| Ga0134074_12832981 | 3300017657 | Grasslands Soil | KSPQEEDMQRSALAPYLQRVETSASTEWSESTVEPKH |
| Ga0184605_103529901 | 3300018027 | Groundwater Sediment | KDPQKEDMQSSALAPYLQRVEGSASTEWSESTVEPKH |
| Ga0066667_104522161 | 3300018433 | Grasslands Soil | TRRIENPTEPPSVDAKGPRDEGVRSSALAPYLQRVEPSASTEWSDSTVEPKH |
| Ga0210407_102223331 | 3300020579 | Soil | PSVEAKGPPEEDTQSSALAPYMRRVEPSAATDWSESKVEPKH |
| Ga0126371_129128231 | 3300021560 | Tropical Forest Soil | AKGPQEEDMRSSALAPYLQRAEASASTEWSESTAEPKH |
| Ga0207663_110925141 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NPTDPSSIGAKGPQKQDMPSSALAPYLQRVEESASTEWSDSAVEPKH |
| Ga0207646_105650972 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IDAKGPQEEDMPSSALAPYLHRVEPSASSEWSESTVEPKH |
| Ga0207700_112918021 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LPSVDANGPRDEDMHSSALTPYLQRVEASGATDWSESAAEPKH |
| Ga0207665_102842694 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ENPTEPSSSVDAKGPQKKDMQSSALAPYLQRAEGSASTEWSESTVEPKH |
| Ga0209468_10683701 | 3300026306 | Soil | LPSVEAKGPQEEDMQNSALAPYLQRVEASASTDWSESAAEPKH |
| Ga0209239_11351902 | 3300026310 | Grasslands Soil | VENPTDAPSVDAKGPRDEDVRSSALAPYLQRAEPSASTEWSDSTVEPKH |
| Ga0307278_102135361 | 3300028878 | Soil | DAKGPRDEDMQSSALAPYLQRVEPSASSEWSESTVEPKH |
| Ga0307278_104563022 | 3300028878 | Soil | GPRDEDMQSSALAPYLQRVEPSVSGEWSESTVEPKH |
| Ga0318541_104747942 | 3300031545 | Soil | IGAKGPQEEDMQSSALASYLHRVEPSASTDWSESTVEPKH |
| Ga0310915_107222261 | 3300031573 | Soil | SVEAKGPQEEDMQNSALAPYLQRDEASASSDWSESAAEPKH |
| Ga0318542_100926551 | 3300031668 | Soil | ENPTDLPSVEAKGPQEEDVQSSALASYLQRVEASASTDWSESTVEPKH |
| Ga0318496_100743984 | 3300031713 | Soil | PTDLPSVEAKGPQEEAMQNSALAPYLQRVEASASTDWSEVGG |
| Ga0306917_108793271 | 3300031719 | Soil | TDLPSVEAKGPQEEDMQNSALAPYLQRVEASASTDWPE |
| Ga0318500_101455403 | 3300031724 | Soil | LPSVEAKGPQEEDVQSSALASYLQRVEASASTDWSESTVEPKH |
| Ga0318501_100287421 | 3300031736 | Soil | VEAEGPQEEGMQDSALAPYLQRAEASASTEWSESAAEPKH |
| Ga0318501_101760223 | 3300031736 | Soil | PSVEAKGPQEEDVQSSALASYLQRVEASASTDWSESTVEPKH |
| Ga0306918_110578862 | 3300031744 | Soil | VENPTDLPSVEAQGPKEEDMQNSALAPYLQRDEASASSDWSESAAEPKH |
| Ga0318543_105635371 | 3300031777 | Soil | LRSVEAKGPQEEAMQNSALAPYLQRVEASASTDWSEVGG |
| Ga0318498_105570551 | 3300031778 | Soil | PQEEDLQSSALAPYLQRVEESASTEWSESTVEPKH |
| Ga0318566_104246051 | 3300031779 | Soil | ENPTDLPSVEAKGPQEEAMQNSALAPYLQRVEASASTDWSEVGG |
| Ga0318547_106503351 | 3300031781 | Soil | ENPTELPSVEAKGPQEEAMQNSALAPYLQRVEASASTDWSEVGG |
| Ga0318552_100007411 | 3300031782 | Soil | KGPKEEDMRGSALAPYLQRAEASASTEWSESTAEPKH |
| Ga0318552_103237322 | 3300031782 | Soil | KGPREEDLQSSALAPYLQRVEESASTEWSESTVEPKH |
| Ga0318576_100269511 | 3300031796 | Soil | DLPSVEAKGPQEEAMQNSALAPYLQRVEASASTDWSEVGG |
| Ga0318576_103210161 | 3300031796 | Soil | RYEAKGPQEEDVQSSALASYLQRVEASASTDWSESTVEPKH |
| Ga0310917_102058142 | 3300031833 | Soil | RRVENPTDQPSVGAKGPQEEDVQSSALASYLHRVEPSASTDWSESTVEPKH |
| Ga0318517_103230432 | 3300031835 | Soil | SIGTKGPQEEDMQGSALASYLHRVEPSASTDWSESTVEPKH |
| Ga0318511_106186721 | 3300031845 | Soil | VENPTDLPSVEAKGPQEEDMQNSALAPYLQRVEASASTDWPE |
| Ga0318512_100279201 | 3300031846 | Soil | LTDLPSVEAKGPQQEDMQNSALAPYLQRVEASASTEWSESAAEPKH |
| Ga0306919_101190523 | 3300031879 | Soil | GPQEEDVQSSALASYLQRVEASASTDWSESTVEPKH |
| Ga0306919_105350631 | 3300031879 | Soil | VDSKGLEKEDMQGSALAPYLERVKESASTEWSESTVESKY |
| Ga0318544_100191533 | 3300031880 | Soil | AKGPQEEDMQSSALASYLHRVEPSASTDWSESTVEPKH |
| Ga0306925_109787961 | 3300031890 | Soil | RRVENPTDLPSVEAKGPQEEDMQNSALAPYLQRVEASASTDWSESAAEPKH |
| Ga0306923_107505153 | 3300031910 | Soil | LPSVEAQGPQEEDMQNSALAPYLQRVEASASTDWPESAAEPKH |
| Ga0310910_113323262 | 3300031946 | Soil | VENPTDLPSVEAKGPQEEDMQNSALAPYLQRFEAPASTDWSESAAEPKH |
| Ga0310909_100022946 | 3300031947 | Soil | MDLSSPADAKRSQKVDRENSALAPYLQRVEDSASTEWSEATVEPKH |
| Ga0310909_107998401 | 3300031947 | Soil | ENPTDLPSVEAKGPQEEDMQNSALAPYLQRVEASASTDWA |
| Ga0306926_100917061 | 3300031954 | Soil | AKGPQEEDVQSSALASYLQRVEASASTDWSESTVEPKH |
| Ga0306926_101917643 | 3300031954 | Soil | DLPSVEAKGPQEEDMQNSALAPYLQRDEASASSDWSESAAEPKH |
| Ga0318507_101249471 | 3300032025 | Soil | VEAKGPPEEDMQNSALAPYLQRVEASASTEWSESAAEPKH |
| Ga0310911_106126602 | 3300032035 | Soil | IGAKGPQEEGMQSSALASYLHRVEPSASTDWSESTVEPKH |
| Ga0318510_103375461 | 3300032064 | Soil | ENPTDLPSVEAEGPQEEGMQDSALAPYLQRAEASASTEWSESAAEPKH |
| Ga0318514_105231701 | 3300032066 | Soil | VEAEGRQEEDIQNSALAPYLQRVEAPASTDWSESAAEPKH |
| Ga0318553_105142971 | 3300032068 | Soil | QPSVGAKGPQEEDVQSSALASYLHRVEPSASTDWSESTVEPKH |
| Ga0318577_100232131 | 3300032091 | Soil | ADAKRSQKVDRENSALAPYLQRVEDSASTEWSEATVEPKH |
| Ga0306920_1026611452 | 3300032261 | Soil | RVENPTDLPSVEAKGPQEEDMQNSALAPYLQRDEASASSDWSESAAEPKH |
| ⦗Top⦘ |