


| Basic Information | |
|---|---|
| Family ID | F098907 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MHRYTYSPSQEALEKRRAAAMDMLAVLAIAAALTLLALAYFDILTF |
| Number of Associated Samples | 50 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.47 % |
| % of genes near scaffold ends (potentially truncated) | 18.45 % |
| % of genes from short scaffolds (< 2000 bps) | 66.02 % |
| Associated GOLD sequencing projects | 37 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.777 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (67.961 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.670 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (90.291 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF08774 | VRR_NUC | 11.65 |
| PF08401 | ArdcN | 10.68 |
| PF03237 | Terminase_6N | 3.88 |
| PF04851 | ResIII | 2.91 |
| PF06114 | Peptidase_M78 | 2.91 |
| PF12708 | Pectate_lyase_3 | 1.94 |
| PF00271 | Helicase_C | 1.94 |
| PF00166 | Cpn10 | 1.94 |
| PF01844 | HNH | 1.94 |
| PF01555 | N6_N4_Mtase | 0.97 |
| PF13392 | HNH_3 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 10.68 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.97 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.22 % |
| Unclassified | root | N/A | 40.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000439|TBL_comb48_EPIDRAFT_1003687 | Not Available | 10132 | Open in IMG/M |
| 3300002930|Water_102015 | Not Available | 3614 | Open in IMG/M |
| 3300003852|Ga0031655_10265726 | Not Available | 643 | Open in IMG/M |
| 3300004448|Ga0065861_1193237 | Not Available | 646 | Open in IMG/M |
| 3300004807|Ga0007809_10025633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2038 | Open in IMG/M |
| 3300004807|Ga0007809_10036942 | Not Available | 1638 | Open in IMG/M |
| 3300006106|Ga0007833_1102380 | Not Available | 505 | Open in IMG/M |
| 3300006108|Ga0007862_1037097 | Not Available | 1031 | Open in IMG/M |
| 3300006805|Ga0075464_10013201 | Not Available | 4122 | Open in IMG/M |
| 3300009068|Ga0114973_10002334 | Not Available | 13823 | Open in IMG/M |
| 3300009068|Ga0114973_10024812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3683 | Open in IMG/M |
| 3300009068|Ga0114973_10620949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300009151|Ga0114962_10026385 | Not Available | 4036 | Open in IMG/M |
| 3300009151|Ga0114962_10027048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3976 | Open in IMG/M |
| 3300009151|Ga0114962_10029060 | All Organisms → cellular organisms → Bacteria | 3810 | Open in IMG/M |
| 3300009151|Ga0114962_10035459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3389 | Open in IMG/M |
| 3300009151|Ga0114962_10106930 | Not Available | 1734 | Open in IMG/M |
| 3300009151|Ga0114962_10120598 | Not Available | 1609 | Open in IMG/M |
| 3300009151|Ga0114962_10130417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1531 | Open in IMG/M |
| 3300009151|Ga0114962_10181717 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300009151|Ga0114962_10713487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300009154|Ga0114963_10059769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2408 | Open in IMG/M |
| 3300009154|Ga0114963_10324014 | Not Available | 852 | Open in IMG/M |
| 3300009155|Ga0114968_10099342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1781 | Open in IMG/M |
| 3300009155|Ga0114968_10139551 | Not Available | 1447 | Open in IMG/M |
| 3300009155|Ga0114968_10411297 | Not Available | 737 | Open in IMG/M |
| 3300009155|Ga0114968_10428714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300009158|Ga0114977_10316463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 886 | Open in IMG/M |
| 3300009159|Ga0114978_10092820 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300009161|Ga0114966_10027247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4253 | Open in IMG/M |
| 3300009164|Ga0114975_10579680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300009181|Ga0114969_10146175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1489 | Open in IMG/M |
| 3300009181|Ga0114969_10782728 | Not Available | 507 | Open in IMG/M |
| 3300009182|Ga0114959_10101194 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300009182|Ga0114959_10280199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas thiooxydans | 837 | Open in IMG/M |
| 3300009182|Ga0114959_10369976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300009684|Ga0114958_10258933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 858 | Open in IMG/M |
| 3300010157|Ga0114964_10488293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. CRKS33 | 579 | Open in IMG/M |
| 3300010157|Ga0114964_10617641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300010158|Ga0114960_10011256 | Not Available | 6095 | Open in IMG/M |
| 3300010158|Ga0114960_10154862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
| 3300010158|Ga0114960_10370431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300010160|Ga0114967_10176313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
| 3300010160|Ga0114967_10190649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
| 3300010160|Ga0114967_10267099 | Not Available | 890 | Open in IMG/M |
| 3300010233|Ga0136235_1004026 | Not Available | 5008 | Open in IMG/M |
| 3300010885|Ga0133913_10236643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4853 | Open in IMG/M |
| 3300010885|Ga0133913_10381393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3727 | Open in IMG/M |
| 3300010885|Ga0133913_10557520 | Not Available | 3013 | Open in IMG/M |
| 3300010885|Ga0133913_10643967 | Not Available | 2779 | Open in IMG/M |
| 3300010885|Ga0133913_11197334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1948 | Open in IMG/M |
| 3300010885|Ga0133913_11328261 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300010885|Ga0133913_11336036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1828 | Open in IMG/M |
| 3300010885|Ga0133913_11447489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1744 | Open in IMG/M |
| 3300010885|Ga0133913_13065690 | Not Available | 1111 | Open in IMG/M |
| 3300010885|Ga0133913_13313808 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
| 3300010885|Ga0133913_13511631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
| 3300013285|Ga0136642_1004860 | All Organisms → Viruses | 4664 | Open in IMG/M |
| 3300013285|Ga0136642_1007508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3546 | Open in IMG/M |
| 3300013285|Ga0136642_1011420 | Not Available | 2743 | Open in IMG/M |
| 3300013285|Ga0136642_1032502 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300013285|Ga0136642_1051792 | Not Available | 1121 | Open in IMG/M |
| 3300013286|Ga0136641_1095877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300015050|Ga0181338_1004903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2274 | Open in IMG/M |
| 3300020686|Ga0214194_110051 | Not Available | 846 | Open in IMG/M |
| 3300020716|Ga0214207_1010829 | All Organisms → Viruses → Predicted Viral | 1208 | Open in IMG/M |
| 3300025382|Ga0208256_1007867 | Not Available | 1755 | Open in IMG/M |
| 3300025382|Ga0208256_1010632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1469 | Open in IMG/M |
| 3300025387|Ga0207959_1000577 | Not Available | 9085 | Open in IMG/M |
| 3300025387|Ga0207959_1010436 | Not Available | 1657 | Open in IMG/M |
| 3300025595|Ga0208248_1037979 | Not Available | 1113 | Open in IMG/M |
| 3300025896|Ga0208916_10181315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300027708|Ga0209188_1004612 | Not Available | 9051 | Open in IMG/M |
| 3300027708|Ga0209188_1010778 | Not Available | 5192 | Open in IMG/M |
| 3300027708|Ga0209188_1021340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3302 | Open in IMG/M |
| 3300027708|Ga0209188_1070637 | Not Available | 1479 | Open in IMG/M |
| 3300027712|Ga0209499_1000293 | Not Available | 37168 | Open in IMG/M |
| 3300027712|Ga0209499_1050197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1720 | Open in IMG/M |
| 3300027712|Ga0209499_1147991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 859 | Open in IMG/M |
| 3300027733|Ga0209297_1268900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 647 | Open in IMG/M |
| 3300027741|Ga0209085_1000205 | All Organisms → cellular organisms → Bacteria | 45850 | Open in IMG/M |
| 3300027741|Ga0209085_1003957 | Not Available | 8020 | Open in IMG/M |
| 3300027741|Ga0209085_1053517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. CRKS33 | 1862 | Open in IMG/M |
| 3300027741|Ga0209085_1059025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1759 | Open in IMG/M |
| 3300027746|Ga0209597_1000272 | Not Available | 34293 | Open in IMG/M |
| 3300027749|Ga0209084_1006144 | Not Available | 7961 | Open in IMG/M |
| 3300027749|Ga0209084_1197565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 811 | Open in IMG/M |
| 3300027754|Ga0209596_1106331 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300027763|Ga0209088_10276006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300027764|Ga0209134_10345296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027770|Ga0209086_10154319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300027777|Ga0209829_10003001 | Not Available | 12509 | Open in IMG/M |
| 3300027777|Ga0209829_10274142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 699 | Open in IMG/M |
| 3300027777|Ga0209829_10328834 | Not Available | 614 | Open in IMG/M |
| 3300027785|Ga0209246_10026347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2196 | Open in IMG/M |
| 3300027808|Ga0209354_10008051 | Not Available | 4223 | Open in IMG/M |
| 3300027896|Ga0209777_10160772 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300027896|Ga0209777_10197297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1621 | Open in IMG/M |
| 3300027896|Ga0209777_10257571 | Not Available | 1369 | Open in IMG/M |
| 3300027896|Ga0209777_10991801 | Not Available | 575 | Open in IMG/M |
| 3300027963|Ga0209400_1075750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1638 | Open in IMG/M |
| 3300027969|Ga0209191_1365881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300031999|Ga0315274_11782260 | Not Available | 566 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 67.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 8.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 4.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.97% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.97% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300006106 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010233 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TBL_comb48_EPIDRAFT_100368712 | 3300000439 | Freshwater | MHRYTYKPSQEALEKRRAAAMDMIAVLIYSVALTVCALAYFDILTF* |
| Water_1020154 | 3300002930 | Estuary Water | MKYTYSPSREAIEKRRAAVMDLLTVLAIAGALTVLALAYFDILTF* |
| Ga0031655_102657262 | 3300003852 | Freshwater Lake Sediment | LTYKENIMHKYTYSPSREQVERRRAAMMDFFAVLVYSAALTLLALDYFDILTF* |
| Ga0065861_11932372 | 3300004448 | Marine | MPDYTYSPSQEAFEKRRAAAMDMLAVLAYSVALTVLALAYFDILTF* |
| Ga0007809_100256335 | 3300004807 | Freshwater | MHRYTYSPSQEQVERRRAAMMDFLAVLIYSAALTLLALDYFDILTF* |
| Ga0007809_100369424 | 3300004807 | Freshwater | MHRYTYSPSQEQVERRRAAAMDMIAVLIYSVALTVCALAYFDILTF* |
| Ga0007833_11023802 | 3300006106 | Freshwater | MHRYTYKPSQEALEKRRAAAMDMIAVLIYSVALTVCALDYFDILTF* |
| Ga0007862_10370972 | 3300006108 | Freshwater | MHRYTYSPSQEQIERRRAAMMDFFAVLVYSAALTLLALDYFNILTF* |
| Ga0075464_100132011 | 3300006805 | Aqueous | MHRYTYKPTQEALEKRRQAAMDFFAVLIYAAGLTLCALAYFDILTF* |
| Ga0114973_1000233410 | 3300009068 | Freshwater Lake | MKYTYSPSREAIEKRRAAAMDLLTVLAIAGALTVLALAYFDILTF* |
| Ga0114973_100248125 | 3300009068 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLAVLAIAAGLTLLGLAYFDILTF* |
| Ga0114973_106209491 | 3300009068 | Freshwater Lake | MHHHYTYSPSQEALEKRRAVAMDMLAVLAIAAGLTLLGLAYFDILTF* |
| Ga0114962_100263858 | 3300009151 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDLLAVLAYSIGLTLLLLAWFDVLTF* |
| Ga0114962_100270484 | 3300009151 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDMLAVLAIAAGLTLLGLAYFDILTF* |
| Ga0114962_100290602 | 3300009151 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDLLAVLAYSISLTLLLLAWFDVLTF* |
| Ga0114962_100354594 | 3300009151 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLAVLVIAAGLTLLGLAYFDILTF* |
| Ga0114962_101069302 | 3300009151 | Freshwater Lake | MHRYTYKPSQEALEKRRAAAMDFFAVLVYAAALTALALAYFDILTF* |
| Ga0114962_101205982 | 3300009151 | Freshwater Lake | MHRYTYKPTQEALEKRRAAAMDILAVLAYAAALTVCALAYFDILTF* |
| Ga0114962_101304175 | 3300009151 | Freshwater Lake | MKYTYSPSQEALEKRRAAAMDLLAVLAIAAALTLLGLAYFDILTF* |
| Ga0114962_101817173 | 3300009151 | Freshwater Lake | MKYTYSPSQEKMEKRRAAAMDFLAVLAYSAVLTVCALAYFDILTF* |
| Ga0114962_107134871 | 3300009151 | Freshwater Lake | LEKRRAAAMDMLAVLAIAAALTLLALAYFDILTF* |
| Ga0114963_100597694 | 3300009154 | Freshwater Lake | MQVLIMHRYTYSPSQEALEKRRAAAMDMLAVLAYSVALTVLALAYFDILTF* |
| Ga0114963_103240141 | 3300009154 | Freshwater Lake | MHRYTYKPTQEALEKRRQAAMDMLAVLVYAAALTALALAYFDILTF* |
| Ga0114968_100993423 | 3300009155 | Freshwater Lake | MHRYTYKPTQEALEKRRAAAMDMLAVLAYSVALTVCALAYFDILTF* |
| Ga0114968_101395515 | 3300009155 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDLLAVLAIAAALTLLGLAYFDILTF* |
| Ga0114968_104112972 | 3300009155 | Freshwater Lake | MKYTYSPSREAIEKRRAAAVDFLTVLAIAGALTVLALAYFDILL* |
| Ga0114968_104287143 | 3300009155 | Freshwater Lake | MHHHYTYKPTQEALEKRRAAAMDMLAVLAIAAAITLLGLAYFDILTF* |
| Ga0114977_103164632 | 3300009158 | Freshwater Lake | MRHHYTYSPSQEALEKRRAAAMDLLAVLAIAGALTVLALAYFDILF* |
| Ga0114978_100928201 | 3300009159 | Freshwater Lake | MKYTYSPSQEKIEKRRAAAMDFLAVLAYSAVLTVCALAYFDILTF* |
| Ga0114966_100272477 | 3300009161 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDFLAVLAYSAVLTVCALAYFDILTF* |
| Ga0114975_105796802 | 3300009164 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLTVLAIAAGLTLLGLAYFDILTF* |
| Ga0114969_101461753 | 3300009181 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDILAVLAIAAGLTLLGL |
| Ga0114969_107827281 | 3300009181 | Freshwater Lake | REAIEKRRAAAMDFLTVLAISGALTVLALAYFDILTF* |
| Ga0114959_101011943 | 3300009182 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDILAVLAYSVALTVLALAYFDILTF* |
| Ga0114959_102801991 | 3300009182 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLAVLAIAAALTLLGL |
| Ga0114959_103699762 | 3300009182 | Freshwater Lake | MHRYTYKPTQEALEKRRAAAMDMLAVLAIAAALTVLALAYFDILTF* |
| Ga0114958_102589332 | 3300009684 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDMLAVLAIAAALTLLALAYFDILTF* |
| Ga0114964_104882931 | 3300010157 | Freshwater Lake | LLQGVNIMHRYTYSPSQEALEKRRAAAMDLLAVLAYSISLTLLLLAWFDVLTF* |
| Ga0114964_106176411 | 3300010157 | Freshwater Lake | LTGEPTMHRYTYKPTQEALEKRRAAAMDVLAILAYAAGLTVCALAYFDILTF* |
| Ga0114960_100112561 | 3300010158 | Freshwater Lake | EALEKRRAAAMDILAVLAYSVALTVLALAYFDILTF* |
| Ga0114960_101548623 | 3300010158 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLAVLAIAAALTLLGLAYFDILTF* |
| Ga0114960_103704311 | 3300010158 | Freshwater Lake | YKPTQEALEKRRAAAMDMLAVLAIAAALTVLALAYFDILTF* |
| Ga0114967_101763135 | 3300010160 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDMLAVLAIAAAFTLLGLAYFDILTF* |
| Ga0114967_101906493 | 3300010160 | Freshwater Lake | MKYTYSPSREAIEKRRAAAMDFLTVLAISGALTVLALAYFDILTF* |
| Ga0114967_102670993 | 3300010160 | Freshwater Lake | HHYTYKPSQEALEKRRAAAMDLLAVLAIAAALTLLGLAYFDILTF* |
| Ga0136235_10040264 | 3300010233 | Freshwater | MKYTYSPSQEALEKRRAAAMDFLAVLAYSAVLTVCALAYFDILTF* |
| Ga0133913_102366436 | 3300010885 | Freshwater Lake | MKYTYSPSREAIEKRRAAAMDFLAVLVIAAGLTLLGLAYFDILTF* |
| Ga0133913_103813932 | 3300010885 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDMLAVLAIAAGLTLLGLAYFDILTF* |
| Ga0133913_105575205 | 3300010885 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDILAVLAYSISLTLLLLAWFDVLTF* |
| Ga0133913_106439674 | 3300010885 | Freshwater Lake | MHHHYTYSPSREAIEKRRAAAMDLLTILAIAAGLTLLGLAYFDILTF* |
| Ga0133913_111973342 | 3300010885 | Freshwater Lake | MHRYTYKPTQEALEKRRQAAMDFFAVLVYAAALTALALAYFDILTF* |
| Ga0133913_113282611 | 3300010885 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDILAVLAIAAGLTLLGLA |
| Ga0133913_113360361 | 3300010885 | Freshwater Lake | KEALEKRRAAAMDMLAVLAYSVALTVLALAYFDILTF* |
| Ga0133913_114474893 | 3300010885 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDMLAVLAYSVALTVLALAYFDILTF* |
| Ga0133913_130656902 | 3300010885 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDMLAVLFIAAGLTLLGLAYFDILTF* |
| Ga0133913_133138085 | 3300010885 | Freshwater Lake | MHRYTYKPTQEALEKRRAAAMDMLAVLVYAAALTALALAYFDILTF* |
| Ga0133913_135116314 | 3300010885 | Freshwater Lake | MHRYTYSPSQEAIEKRRAAAMDMLAVLAYSVALTVLALAYFDILTF* |
| Ga0136642_10048604 | 3300013285 | Freshwater | MRHHYTYSPSQEALEKRRAAAMDMLAVLAYSVALTLLLLAWFDIITF* |
| Ga0136642_10075088 | 3300013285 | Freshwater | QEALEKRRAAAMDILAVLAYSVALTLLLLAYFDILTF* |
| Ga0136642_10114206 | 3300013285 | Freshwater | MRHHYTYSPSQEALEKRRAAAMDMLAVLACSIGLTLLLLAYFDILTF* |
| Ga0136642_10325024 | 3300013285 | Freshwater | MRHHYTYSPSQEALEKRRAAAMDILAVLAYSVALTLLLLAYFDILTF* |
| Ga0136642_10517925 | 3300013285 | Freshwater | RHHYTYSPSQEALEKRRAAAMDILAVLACSIGLTLLLLAYFDILTF* |
| Ga0136641_10958772 | 3300013286 | Freshwater | MKYTYSPSQEKMEKRRAAAMDFLAVLAYSAGLTLLGLAYFDILTF* |
| Ga0181338_10049035 | 3300015050 | Freshwater Lake | MHRYTYKPTQEALERRRAAAMDFFAVLVYAAGLTLCALAYFDILTF* |
| Ga0214194_1100511 | 3300020686 | Freshwater | MHRYTYKPSQEALEKRRAAAMDMIAVLIYSVALTVCALAYFDILTF |
| Ga0214207_10108292 | 3300020716 | Freshwater | MHRYTYSPSQEQVERRRAAMMDFFAVLVYSAALTLLALDYFDILTF |
| Ga0208256_10078672 | 3300025382 | Freshwater | MHRYTYSPSQEQVERRRAAAMDMIAVLIYSVALTVCALAYFDILTF |
| Ga0208256_10106322 | 3300025382 | Freshwater | MHRYTYSPSQEQVERRRAAMMDFLAVLIYSAALTVCALAYFDILTF |
| Ga0207959_10005772 | 3300025387 | Freshwater | MHRYTYKPSQEALEKRRAAAMDMIAVLIYSVALTVCALDYFDILTF |
| Ga0207959_10104365 | 3300025387 | Freshwater | HRYTYSPSQEQVERRRAAAMDMIAVLIYSVALTVCALAYFDILTF |
| Ga0208248_10379794 | 3300025595 | Freshwater | MKYTYSPSREAIEKRRAAAMDFLTVLAIAGALTVLALAYFDILTF |
| Ga0208916_101813151 | 3300025896 | Aqueous | MHRYTYKPTQEALEKRRQAAMDFFAVLIYAAGLTLCALAYFDILTF |
| Ga0209188_10046124 | 3300027708 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDLLAVLAYSIGLTLLLLAWFDVLTF |
| Ga0209188_101077810 | 3300027708 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDMLAVLAIAAGLTLLGLA |
| Ga0209188_10213405 | 3300027708 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDILAVLAYSVALTVLALAYFDILTF |
| Ga0209188_10706375 | 3300027708 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLAVLAIAAALTLLGLAYFDILTF |
| Ga0209499_100029332 | 3300027712 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDMLAVLAIAAGLTLLGLAYFDILTF |
| Ga0209499_10501974 | 3300027712 | Freshwater Lake | MKYTYSPSQEALEKRRAAAMDLLAVLAIAAALTLLGLAYFDILTF |
| Ga0209499_11479913 | 3300027712 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDMLAVLAIAAALTLLALAYFDILTF |
| Ga0209297_12689002 | 3300027733 | Freshwater Lake | MRHHYTYSPSQEALEKRRAAAMDLLAVLAIAGALTVLALAYFDILF |
| Ga0209085_100020532 | 3300027741 | Freshwater Lake | MKYTYSPSREAIEKRRAAAMDLLTVLAIAGALTVLALAYFDILTF |
| Ga0209085_10039578 | 3300027741 | Freshwater Lake | MHRYTYKPTQEALEKRRAAAMDILAVLAYAAALTVCALAYFDILTF |
| Ga0209085_10535172 | 3300027741 | Freshwater Lake | MHRYTYKPSQEALEKRRAAAMDFFAVLVYAAALTALALAYFDILTF |
| Ga0209085_10590254 | 3300027741 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDMLAVLAYSVALTVLALAYFDILTF |
| Ga0209597_100027243 | 3300027746 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLAVLAIAAGLTLLGLAYFDILTF |
| Ga0209084_10061449 | 3300027749 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDLLAVLAYSISLTLLLLAWFDVLTF |
| Ga0209084_11975653 | 3300027749 | Freshwater Lake | MKYTYSPSQEKMEKRRAAAMDFLAVLAYSAVLTVCALAYFDILTF |
| Ga0209596_11063314 | 3300027754 | Freshwater Lake | MHHHYTYKPSQEALEKRRAAAMDILAVLAIAAGLTLLGLAYFDILTF |
| Ga0209088_102760063 | 3300027763 | Freshwater Lake | MRYTYSPSREAIEKRRAAAMDFLTVVAIAGALTVLALAYFDILTF |
| Ga0209134_103452961 | 3300027764 | Freshwater Lake | MHRYTYKPTQEALERRRAAAMDFFAVLVYAAGLTLCALAYFDILTF |
| Ga0209086_101543192 | 3300027770 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDFLAVLAYSAVLTVCALAYFDILTF |
| Ga0209829_1000300114 | 3300027777 | Freshwater Lake | MHRYTYSPSQEALEKRRAAAMDILAVLAYSISLTLLLLAWFDVLTF |
| Ga0209829_102741423 | 3300027777 | Freshwater Lake | MKYTYSPSQEALEKRRAAAMDMLAVLAIAAALTLLGLAYFDILTF |
| Ga0209829_103288342 | 3300027777 | Freshwater Lake | MHRYTYKPTQEALEKRRQAAMDFFAVLVYAAALTALALAYFDILTF |
| Ga0209246_100263474 | 3300027785 | Freshwater Lake | MHRYTYKPTQESLEKRRQAAMDFFAVLVYAAGLTLCALAYFDILTF |
| Ga0209354_100080518 | 3300027808 | Freshwater Lake | MHRYTYKPTQEALEKRRQAAMDFFAVLVYAAGLTLCALAYF |
| Ga0209777_101607723 | 3300027896 | Freshwater Lake Sediment | MHRYTYKPSQEALEKRRAAAMDMIAVLIYSAALTLLALDYFDILTF |
| Ga0209777_101972971 | 3300027896 | Freshwater Lake Sediment | PSQEQVERRRAAAMDMIAVLIYSVALTVCALAYFDILTF |
| Ga0209777_102575711 | 3300027896 | Freshwater Lake Sediment | SLNILAYKENIMHKYTYSPSQEQVERRRAAMMDFFAVLVYSAALTLLALDYFDILTF |
| Ga0209777_109918012 | 3300027896 | Freshwater Lake Sediment | MHKYTYSPSREQVERRRAAMMDFFAVLVYSAALTLLALDYFDILTF |
| Ga0209400_10757506 | 3300027963 | Freshwater Lake | MHRYTYKPTQEALEKRRAAAMDMLAVLAYSVALTVCALAYFDILTF |
| Ga0209191_13658812 | 3300027969 | Freshwater Lake | MHHHYTYSPSQEALEKRRAAAMDLLTVLAIAAGLTLLGLAYFDILTF |
| Ga0315274_117822602 | 3300031999 | Sediment | MHHHYTYKPSQEALEKRRAAAMDLLAVLAIAAALTLLGLAYFDILTF |
| ⦗Top⦘ |