


| Basic Information | |
|---|---|
| Family ID | F098884 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQAY |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.92 % |
| % of genes near scaffold ends (potentially truncated) | 92.23 % |
| % of genes from short scaffolds (< 2000 bps) | 90.29 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.728 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.272 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.922 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.398 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02627 | CMD | 46.60 |
| PF02615 | Ldh_2 | 4.85 |
| PF02586 | SRAP | 1.94 |
| PF13417 | GST_N_3 | 0.97 |
| PF02353 | CMAS | 0.97 |
| PF00011 | HSP20 | 0.97 |
| PF04392 | ABC_sub_bind | 0.97 |
| PF03733 | YccF | 0.97 |
| PF11300 | DUF3102 | 0.97 |
| PF09523 | DUF2390 | 0.97 |
| PF03548 | LolA | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 46.60 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 46.60 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 4.85 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.94 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.97 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.97 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.97 |
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.97 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.73 % |
| Unclassified | root | N/A | 24.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02QWO6C | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 519 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11121501 | Not Available | 534 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1025914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 923 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1006620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2213 | Open in IMG/M |
| 3300000787|JGI11643J11755_11116576 | Not Available | 539 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10068649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 768 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1043170 | Not Available | 636 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1017484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1031242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 841 | Open in IMG/M |
| 3300000956|JGI10216J12902_101743780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 827 | Open in IMG/M |
| 3300001661|JGI12053J15887_10291858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 799 | Open in IMG/M |
| 3300001867|JGI12627J18819_10083779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1323 | Open in IMG/M |
| 3300005332|Ga0066388_102524965 | Not Available | 934 | Open in IMG/M |
| 3300005558|Ga0066698_10936695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300005587|Ga0066654_10515929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300005713|Ga0066905_100448677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300005713|Ga0066905_102283455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005764|Ga0066903_107483653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 563 | Open in IMG/M |
| 3300006806|Ga0079220_11522677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 575 | Open in IMG/M |
| 3300007258|Ga0099793_10077493 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300009012|Ga0066710_100729808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1513 | Open in IMG/M |
| 3300009143|Ga0099792_10662619 | Not Available | 671 | Open in IMG/M |
| 3300010047|Ga0126382_11429243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 632 | Open in IMG/M |
| 3300010303|Ga0134082_10253550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300010360|Ga0126372_10921653 | Not Available | 878 | Open in IMG/M |
| 3300010360|Ga0126372_12816858 | Not Available | 538 | Open in IMG/M |
| 3300010376|Ga0126381_100277058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2286 | Open in IMG/M |
| 3300012199|Ga0137383_10455204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300012202|Ga0137363_10326588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1265 | Open in IMG/M |
| 3300012203|Ga0137399_10241395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1479 | Open in IMG/M |
| 3300012355|Ga0137369_10680681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 708 | Open in IMG/M |
| 3300012356|Ga0137371_11353203 | Not Available | 524 | Open in IMG/M |
| 3300012683|Ga0137398_10624347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 746 | Open in IMG/M |
| 3300012939|Ga0162650_100083578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 553 | Open in IMG/M |
| 3300012941|Ga0162652_100082366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 560 | Open in IMG/M |
| 3300013297|Ga0157378_11099275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 832 | Open in IMG/M |
| 3300014157|Ga0134078_10548528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 545 | Open in IMG/M |
| 3300014325|Ga0163163_10203763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2027 | Open in IMG/M |
| 3300015242|Ga0137412_10563531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 866 | Open in IMG/M |
| 3300015371|Ga0132258_10444086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3232 | Open in IMG/M |
| 3300015374|Ga0132255_102229571 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300016319|Ga0182033_10630762 | Not Available | 933 | Open in IMG/M |
| 3300016341|Ga0182035_11357465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 637 | Open in IMG/M |
| 3300016387|Ga0182040_11572398 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300016422|Ga0182039_10654174 | Not Available | 923 | Open in IMG/M |
| 3300016422|Ga0182039_11623980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 590 | Open in IMG/M |
| 3300017657|Ga0134074_1255850 | Not Available | 631 | Open in IMG/M |
| 3300018053|Ga0184626_10182578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 891 | Open in IMG/M |
| 3300018072|Ga0184635_10350521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 567 | Open in IMG/M |
| 3300018431|Ga0066655_10586554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300018482|Ga0066669_12221072 | Not Available | 521 | Open in IMG/M |
| 3300019356|Ga0173481_10351370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 704 | Open in IMG/M |
| 3300019876|Ga0193703_1037928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 747 | Open in IMG/M |
| 3300024055|Ga0247794_10254636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 581 | Open in IMG/M |
| 3300025960|Ga0207651_10707702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 888 | Open in IMG/M |
| 3300026358|Ga0257166_1069778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 512 | Open in IMG/M |
| 3300026899|Ga0209326_1007495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 817 | Open in IMG/M |
| 3300027288|Ga0208525_1037670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 597 | Open in IMG/M |
| 3300027603|Ga0209331_1155548 | Not Available | 540 | Open in IMG/M |
| 3300027874|Ga0209465_10036629 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300027909|Ga0209382_12220459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 518 | Open in IMG/M |
| 3300028720|Ga0307317_10280838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 562 | Open in IMG/M |
| 3300028807|Ga0307305_10250371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 809 | Open in IMG/M |
| 3300031226|Ga0307497_10563333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300031231|Ga0170824_124185905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031446|Ga0170820_11252320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031544|Ga0318534_10541861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 663 | Open in IMG/M |
| 3300031546|Ga0318538_10346247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 802 | Open in IMG/M |
| 3300031573|Ga0310915_10701241 | Not Available | 715 | Open in IMG/M |
| 3300031668|Ga0318542_10435464 | Not Available | 679 | Open in IMG/M |
| 3300031681|Ga0318572_10092942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1692 | Open in IMG/M |
| 3300031682|Ga0318560_10101688 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300031682|Ga0318560_10312591 | Not Available | 847 | Open in IMG/M |
| 3300031736|Ga0318501_10154043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1184 | Open in IMG/M |
| 3300031751|Ga0318494_10276159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 966 | Open in IMG/M |
| 3300031781|Ga0318547_10469984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 775 | Open in IMG/M |
| 3300031794|Ga0318503_10030231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1584 | Open in IMG/M |
| 3300031796|Ga0318576_10592822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300031833|Ga0310917_10505920 | Not Available | 822 | Open in IMG/M |
| 3300031890|Ga0306925_10304697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1713 | Open in IMG/M |
| 3300031893|Ga0318536_10115265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1354 | Open in IMG/M |
| 3300031896|Ga0318551_10382058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 799 | Open in IMG/M |
| 3300031946|Ga0310910_11513735 | Not Available | 514 | Open in IMG/M |
| 3300032001|Ga0306922_10430954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1410 | Open in IMG/M |
| 3300032001|Ga0306922_11126159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300032001|Ga0306922_11230748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300032001|Ga0306922_12275768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 520 | Open in IMG/M |
| 3300032009|Ga0318563_10394043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 749 | Open in IMG/M |
| 3300032039|Ga0318559_10038929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1944 | Open in IMG/M |
| 3300032042|Ga0318545_10258622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 625 | Open in IMG/M |
| 3300032043|Ga0318556_10316860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 815 | Open in IMG/M |
| 3300032043|Ga0318556_10419968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 699 | Open in IMG/M |
| 3300032044|Ga0318558_10396942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 686 | Open in IMG/M |
| 3300032055|Ga0318575_10320186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Mycoplana → Mycoplana dimorpha | 785 | Open in IMG/M |
| 3300032076|Ga0306924_10353254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1685 | Open in IMG/M |
| 3300032090|Ga0318518_10092424 | Not Available | 1502 | Open in IMG/M |
| 3300032261|Ga0306920_101122432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300032261|Ga0306920_101402080 | Not Available | 1001 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 7.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.97% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_02625590 | 2070309004 | Green-Waste Compost | MGFFRTAGAVATLLVGLGASGGEALAQYYPPAQAYPPPQA |
| ICChiseqgaiiFebDRAFT_111215011 | 3300000363 | Soil | MVFRTAGAIVTLLIGLGSAGGEALAQYYPPPQGYPTQ |
| AF_2010_repII_A01DRAFT_10259143 | 3300000580 | Forest Soil | MVFRTAGAIAALLIGLGTPGGEALAQYYPPAQAYPPSQAYPPAQGYRPSVADA |
| AF_2010_repII_A100DRAFT_10066201 | 3300000655 | Forest Soil | MVFRTAGAIATLLIGLGLSAGDAFAQYYPPGQPPQGYLPSRPLPP |
| JGI11643J11755_111165761 | 3300000787 | Soil | MVFRTAGAIVTLLIGLGSAGGEALAQYYPPPQGYPTQAY |
| AF_2010_repII_A001DRAFT_100686493 | 3300000793 | Forest Soil | MVFRTAGAIAALLTGLGLSGGGASAQYYPPAQAYPPPQTYPPAQGYP |
| AP72_2010_repI_A100DRAFT_10431702 | 3300000837 | Forest Soil | MVFRIAGAIATLLIGLGSAGGQALAQYYPPPRTYPPQAY |
| AP72_2010_repI_A001DRAFT_10174843 | 3300000893 | Forest Soil | MVFRTAGAIAALLIGLGASGEALAQYYPPAPAYPP |
| AP72_2010_repI_A001DRAFT_10312421 | 3300000893 | Forest Soil | MVFRTAGAVATLLIGLGASGGEALAQYYPPAQAYPPSQAYPPP |
| JGI10216J12902_1017437802 | 3300000956 | Soil | MVFRMVSAIAALLIFFGALGGKALAQYYPPVQAYPPPQAYPPQGY |
| JGI10216J12902_1161299762 | 3300000956 | Soil | MGFRTVCAMAALLIGLETSGGKASAQYYYPPAQAAYPPPQAYPPQVYYPRQGYRPP |
| JGI12053J15887_102918581 | 3300001661 | Forest Soil | MIFRTSGAIAALLIGLVGPSGQALAQYSPPSQAYPPPQA |
| JGI12627J18819_100837791 | 3300001867 | Forest Soil | LPEGKGDMVFRTASAMAALLIGLGGAGGQALAQYYPPAQA |
| Ga0066388_1025249651 | 3300005332 | Tropical Forest Soil | MVFRTVSAVVVLLICLGASGGKAWAQYYPPAQAYPPPQAYPRGYHPRQP |
| Ga0066388_1083374101 | 3300005332 | Tropical Forest Soil | MVFRTVSAIAALMIWFGASGGKALAQYYLPAQAYSPLQAYPPQVYYPRQGYRPPVVMTMTTMT* |
| Ga0066698_109366952 | 3300005558 | Soil | MVFRTAGAIAALLTGLGLSGGGASAQYYPPAQGYPPPQAYPPAQGYPA |
| Ga0066654_105159291 | 3300005587 | Soil | MVFRTAGAIVTLLISLGCAGGEALAQYYPPQGYPTQAYP |
| Ga0066905_1004486771 | 3300005713 | Tropical Forest Soil | MVFRTAGAIATLLIGLGASAGDVLAQYYPPAPAYPP |
| Ga0066905_1022834552 | 3300005713 | Tropical Forest Soil | MVFRTVSAIAALVIFFGASGGKALAQYYPPVQAYPPPQAYPPQGYY |
| Ga0066903_1043804973 | 3300005764 | Tropical Forest Soil | MVFRTAGALATLLIAFEAGGGQALAQYYPATQVYPAKQGYSPPPADSSS |
| Ga0066903_1074836532 | 3300005764 | Tropical Forest Soil | MVFRTAGAIAALLIGLGASGSEALAQYYPPAQPYPP |
| Ga0079220_115226771 | 3300006806 | Agricultural Soil | MVFRTAGAIAALLTGLGLSGGGALAQYYPPAQAYPPPQA |
| Ga0099793_100774934 | 3300007258 | Vadose Zone Soil | MNFRTTGAIAALLIGLGASAGDASAQYYPQPQAYPPAYPPAQGYP |
| Ga0066710_1007298081 | 3300009012 | Grasslands Soil | MVFRTAGAIVTLLISLGCAGGEALAQYYPPPQGYPTQA |
| Ga0099792_106626191 | 3300009143 | Vadose Zone Soil | MVFRTVSAIAVLLICFGASGGETLAQYYPPARAYPPPQTYPPQGYYPR |
| Ga0126374_100449453 | 3300009792 | Tropical Forest Soil | MVFRTVSATAALLISLGASGGKASAQYYPPVQAYPLPQAYPPQGYYPRQGYRP |
| Ga0126382_114292432 | 3300010047 | Tropical Forest Soil | MVFRTAGAIAALLTGLGLSGGGASAQYFPPAQAYP |
| Ga0134082_102535502 | 3300010303 | Grasslands Soil | MVFRTAGAIVTLLIGLGSAGGEALAQYYPPPQGYPT |
| Ga0126372_109216533 | 3300010360 | Tropical Forest Soil | MVLRAASAVVVLLICLGASGGKAWAQYYPPAQAYPPPQAYPRG |
| Ga0126372_128168582 | 3300010360 | Tropical Forest Soil | MIFRTAGAIAALFLGLGGAGGQALAQYYPPAQAYP |
| Ga0126381_1002770584 | 3300010376 | Tropical Forest Soil | MVFRTAGAIAALLTGLGLSGGGASAQYYPPAQAYPPPQAYPPAQGYP |
| Ga0137383_104552041 | 3300012199 | Vadose Zone Soil | MVFRTVSAIAALLIFFGASGGKALAQYYPPVQAYPPPQA |
| Ga0137363_103265881 | 3300012202 | Vadose Zone Soil | MVFRTAGAIATLLIGLDSAGGEALAQYYPPPQGYPTQAY |
| Ga0137399_102413951 | 3300012203 | Vadose Zone Soil | MVFRTAGAIAALLIGLGTTGDRASAQYYPPSQAYPPPQAY |
| Ga0137369_106806812 | 3300012355 | Vadose Zone Soil | MIFRTTGAVATLLIGLAGSGGQALAQYYPPPPQAYP |
| Ga0137371_113532031 | 3300012356 | Vadose Zone Soil | MVFRTVSAIVALLIFFGASGGKALAQYYPPVQAYP |
| Ga0137398_106243471 | 3300012683 | Vadose Zone Soil | MVFRTVGAAATLLVGLAWPDGQALAQYYAQPPQVYELPPGT |
| Ga0162650_1000835781 | 3300012939 | Soil | MVFRTAGAIAALLIGLGTVGDQALAQYYPPPQAYPPPQAYP |
| Ga0162652_1000823662 | 3300012941 | Soil | MVFRTAGAIATLLIGLGASAGDALAQYYPPAQAYPPPQAYPPAQGYP |
| Ga0157378_110992751 | 3300013297 | Miscanthus Rhizosphere | MVFRTAGAIAALLIGLGTSGGQALAQYYPPPQAYPPPHA* |
| Ga0134078_105485281 | 3300014157 | Grasslands Soil | MVFRTAGAITTLLIGLGASAGDALAQYYPPAQAYPPPQAHPP |
| Ga0163163_102037634 | 3300014325 | Switchgrass Rhizosphere | MVFRTAGAIAALLIGLGTSGDQALAQYYPSPQAYPPSH |
| Ga0137412_105635313 | 3300015242 | Vadose Zone Soil | MVFRTAGAIAALLAGLGLSGGGASAQYYPPAQAYPPPQAYP |
| Ga0132258_104440866 | 3300015371 | Arabidopsis Rhizosphere | MGFRTVCAIAALLIGLDASGGKASAQYYPPAQAYPPPQAYPQVYPSAGLSSARGG* |
| Ga0132258_117355853 | 3300015371 | Arabidopsis Rhizosphere | MGFRTVCAIAALVIGLEAWGGKASAQYYPPAQAYPPPPQVYYPRQGYRP |
| Ga0132255_1022295712 | 3300015374 | Arabidopsis Rhizosphere | MVFRTAGAIAALLIGLGTTGAHASAQYYPPPQAYPPPQAYP |
| Ga0182033_106307623 | 3300016319 | Soil | MIVRTAGAIATLLIALGGLSTQALAQYYPPAQAYPPQDYP |
| Ga0182035_113574652 | 3300016341 | Soil | MVVRTAGALATLLIGLTGPGGHALAQYSPLPAQAYPPAQAYPPPT |
| Ga0182040_115723982 | 3300016387 | Soil | MVLRTAGAIVTLLIGLGAQALAQPYPPQQAYPRQPFPSSDELP |
| Ga0182039_106541741 | 3300016422 | Soil | MIVRMAGAIATLLIAFGGLSTQALAQYYPPAQAYPP |
| Ga0182039_116239801 | 3300016422 | Soil | MIFRTAAGAASAILLGLAASAGDAGAQYYPAPQAYPSQAYPPAQGYPRYGASP |
| Ga0134074_12558501 | 3300017657 | Grasslands Soil | MVFRTVSAIAALLIFFGASGGKALAQYYPPVQAYPPPQAYPPQG |
| Ga0184626_101825783 | 3300018053 | Groundwater Sediment | MVFRTAGAITALLLGFGGQALAQYYPPAPQSYPPPQ |
| Ga0184635_103505212 | 3300018072 | Groundwater Sediment | MVFRTAGAIAALLIGLGTIGDQALAQYYPPPQAYPPPQAY |
| Ga0066655_105865541 | 3300018431 | Grasslands Soil | MVFRTVSAIAALLIFFGASGGKALAQYYPPVQAYP |
| Ga0066669_122210721 | 3300018482 | Grasslands Soil | MVFRTASAIATLLIGFGGAGGQALAQYYPPAQTYPPQGYPTRQPLP |
| Ga0173481_103513702 | 3300019356 | Soil | MVFRTAGAIAALLIGLGTSGDQALAQYYPSPQAYP |
| Ga0193703_10379282 | 3300019876 | Soil | MVFRTAGAIAALLIGLGTIGDQALAQYYPPPQAYPPPQ |
| Ga0247794_102546361 | 3300024055 | Soil | MVFRTAGAIAALLIGMGTSGDQALAQYYPPPQAYPPPQ |
| Ga0207651_107077021 | 3300025960 | Switchgrass Rhizosphere | MVFRTAGAIAALLIGLGTSGDQALAQYYPSPQAYPPSHAYPPPQAY |
| Ga0257166_10697782 | 3300026358 | Soil | MNFRTTGAIAALLIGLGASAGDASAQYYPQPQAYPP |
| Ga0209326_10074951 | 3300026899 | Forest Soil | MVFRTAGAIAALLIGLGASGGGALAQYYPAPQAYPPQAYPPPQGYRPSVAD |
| Ga0208525_10376701 | 3300027288 | Soil | MVFRTAGAIAALLIGLGASGGGALAQYYPPPQAYPPQAYP |
| Ga0209331_11555482 | 3300027603 | Forest Soil | MVFCTAGAIATLLIGVSGQTLAQYHPPPQVYPRQALPP |
| Ga0209465_100366291 | 3300027874 | Tropical Forest Soil | MIFRTVSAIAALMICVGALGGRALAQYYPPAQPYPPSQVYP |
| Ga0209382_122204591 | 3300027909 | Populus Rhizosphere | MIFRTAGAIATLLLGLGGSGSQALAQFYPPPPAYPP |
| Ga0307317_102808382 | 3300028720 | Soil | MVFRTAGAIAALLIGLGTTGDHASAQYYPPPQAYPPPQAY |
| Ga0307305_102503711 | 3300028807 | Soil | MVFRTAGAIAALLIGLGTTGDQALAQYYPPPQAYPPPQ |
| Ga0307497_105633331 | 3300031226 | Soil | MVFRTVSAIAALLVCLGASGGKALAQYYPPAQAYPPPQAYPPQIYY |
| Ga0170824_1241859053 | 3300031231 | Forest Soil | MVFRTAGAIATVLIGVTGQALAQYYPPPQAYPRPS |
| Ga0170820_112523202 | 3300031446 | Forest Soil | MVFRTAGVIAAVMIVLSGQTLAQYYPPPQVYPRQPLPP |
| Ga0318534_105418611 | 3300031544 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQAYPPQ |
| Ga0318538_103462473 | 3300031546 | Soil | MVFRTTGAIAALLIGLGASGGDALAQYYPPPQAYPPQTYPP |
| Ga0310915_107012411 | 3300031573 | Soil | MIVRTVGAIATLLIALGGLSTQALAQYYPPAQAYPPQDYPPAQTYSR |
| Ga0318542_104354643 | 3300031668 | Soil | MIFRTVSAIAALMICVGALGGRALAQYYPPAQPYPPSQVYPPEGYY |
| Ga0318572_100929421 | 3300031681 | Soil | MIFRAVSAIAALMICVGALGGRALAQYYPPAQPYPPSQVYPPEGYY |
| Ga0318560_101016884 | 3300031682 | Soil | MVFRTTGAIAALLIGLGASGGDALAQYYPPPQAYPPQTY |
| Ga0318560_103125912 | 3300031682 | Soil | MIVRTVGAIATLLIALGGLSTQALAQYYPPAQAYPPQD |
| Ga0318501_101540431 | 3300031736 | Soil | MVFRTAGVIATLVIGLGASQALAQYYPPAPVYPPAPVY |
| Ga0318494_102761591 | 3300031751 | Soil | MVFRTAGAIAALLIGLGTPGGQALAQYYPPPQAYPPPQA |
| Ga0318547_104699841 | 3300031781 | Soil | MVFRTAGAVAVLLIGLGTPGGEALAQYYPPAQAYPP |
| Ga0318503_100302311 | 3300031794 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQ |
| Ga0318576_105928222 | 3300031796 | Soil | MVFRTVSAIAALLIFFGASGGKALAQYYPPVQAYPPPQAYPPQGYYP |
| Ga0310917_105059202 | 3300031833 | Soil | MIVRTAGAIATLLIALGGLSTQALAQYYPPAQAYPPQD |
| Ga0306925_103046971 | 3300031890 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYP |
| Ga0318536_101152654 | 3300031893 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQAYPP |
| Ga0318551_103820581 | 3300031896 | Soil | MVFRTAGAVAVLLIGLGTPGGEALAQYYPPAQAYPPSQAYPPPQGYRPSVA |
| Ga0310910_115137351 | 3300031946 | Soil | MIFRTAGAIAALLIGLGMSAGDTFAQYYPPGQAYPPPQAYPPAQGHPSS |
| Ga0306922_104309544 | 3300032001 | Soil | MVFRTAGAVAVLLIGLGTPGGEALAQYYPPAQAYPRPSVAD |
| Ga0306922_111261592 | 3300032001 | Soil | MVFRTAGAIATLVIGLGGAGGQALAQYHPPPEAYPPR |
| Ga0306922_112307481 | 3300032001 | Soil | MIFRRVSAIAALLISLGASGKALAQYYPPVQAYPPPQAY |
| Ga0306922_122757681 | 3300032001 | Soil | MVFRTAGAIAALLIGLGTSSGEALAQYYPPGQAYPPPPQAYP |
| Ga0318563_103940431 | 3300032009 | Soil | MVFRTAGAIAALLIGLGTPGGEALAQYYPPAQAYPPP |
| Ga0318559_100389294 | 3300032039 | Soil | MVFRTAGVIATLVIGLGASQALAQYYPPAPVYPPA |
| Ga0318545_102586221 | 3300032042 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQAYPPQAY |
| Ga0318556_103168603 | 3300032043 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQAY |
| Ga0318556_104199681 | 3300032043 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQA |
| Ga0318558_103969421 | 3300032044 | Soil | MVFRTAGAIAALLIGLGASGGEALAQYYPPPQAYPPQAYP |
| Ga0318575_103201861 | 3300032055 | Soil | MIFRTAGAIAALLIGLGMSAGDTFAQYYPPGQAYPP |
| Ga0306924_103532541 | 3300032076 | Soil | MVFRTAGAVAVLLIGLGTPGGEALAQYYPPAQAYPPS |
| Ga0318518_100924241 | 3300032090 | Soil | MVFRTAGAVATLLIGLGASGGEALAQYYPPAQAYPPSQAY |
| Ga0306920_1011224323 | 3300032261 | Soil | MIFRTVSAIAALMICVGALGGRALAQYYPPAQPYPPSQ |
| Ga0306920_1014020801 | 3300032261 | Soil | MIVRTVGAIATLLIALGGLSTQALAQYYPPAQAYPPQDYPPAQTY |
| ⦗Top⦘ |