


| Basic Information | |
|---|---|
| Family ID | F098844 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AYWQKLLGALTSQAEEVRALSTKVAAAAGEPLKEQVKRGVDELRKAN |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.83 % |
| % of genes near scaffold ends (potentially truncated) | 93.20 % |
| % of genes from short scaffolds (< 2000 bps) | 97.09 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.757 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.388 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.718 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.00% β-sheet: 0.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 21.36 |
| PF09361 | Phasin_2 | 9.71 |
| PF00313 | CSD | 1.94 |
| PF03330 | DPBB_1 | 0.97 |
| PF01327 | Pep_deformylase | 0.97 |
| PF11752 | DUF3309 | 0.97 |
| PF03734 | YkuD | 0.97 |
| PF01950 | FBPase_3 | 0.97 |
| PF00903 | Glyoxalase | 0.97 |
| PF12244 | DUF3606 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.97 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| COG1980 | Archaeal fructose 1,6-bisphosphatase | Carbohydrate transport and metabolism [G] | 0.97 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.76 % |
| Unclassified | root | N/A | 25.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01CRRH6 | Not Available | 500 | Open in IMG/M |
| 3300000559|F14TC_100315371 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300000567|JGI12270J11330_10013151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5397 | Open in IMG/M |
| 3300002155|JGI24033J26618_1069588 | Not Available | 527 | Open in IMG/M |
| 3300003287|Ga0006882J48912_107788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 613 | Open in IMG/M |
| 3300003990|Ga0055455_10054727 | Not Available | 1101 | Open in IMG/M |
| 3300005338|Ga0068868_102065676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 542 | Open in IMG/M |
| 3300005367|Ga0070667_101562956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 620 | Open in IMG/M |
| 3300005435|Ga0070714_100589453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1067 | Open in IMG/M |
| 3300005539|Ga0068853_100285408 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300005539|Ga0068853_100587991 | Not Available | 1056 | Open in IMG/M |
| 3300005842|Ga0068858_101825401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 601 | Open in IMG/M |
| 3300006058|Ga0075432_10596699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 504 | Open in IMG/M |
| 3300006845|Ga0075421_101870860 | Not Available | 643 | Open in IMG/M |
| 3300006881|Ga0068865_101317180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 643 | Open in IMG/M |
| 3300007076|Ga0075435_100262231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1472 | Open in IMG/M |
| 3300007076|Ga0075435_101017651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 723 | Open in IMG/M |
| 3300009011|Ga0105251_10614279 | Not Available | 517 | Open in IMG/M |
| 3300009146|Ga0105091_10254789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Kordiimonadales → Kordiimonadaceae → Kordiimonas → Kordiimonas lacus | 847 | Open in IMG/M |
| 3300009147|Ga0114129_11520063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 822 | Open in IMG/M |
| 3300009147|Ga0114129_11699046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 770 | Open in IMG/M |
| 3300009147|Ga0114129_12753513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 585 | Open in IMG/M |
| 3300009156|Ga0111538_12975718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 592 | Open in IMG/M |
| 3300009168|Ga0105104_10618725 | Not Available | 617 | Open in IMG/M |
| 3300009520|Ga0116214_1241171 | Not Available | 685 | Open in IMG/M |
| 3300009521|Ga0116222_1005346 | All Organisms → cellular organisms → Bacteria | 6332 | Open in IMG/M |
| 3300009524|Ga0116225_1446820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 574 | Open in IMG/M |
| 3300009545|Ga0105237_10973106 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300009545|Ga0105237_12706611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 507 | Open in IMG/M |
| 3300009553|Ga0105249_11854312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 676 | Open in IMG/M |
| 3300009553|Ga0105249_11879332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 671 | Open in IMG/M |
| 3300009678|Ga0105252_10433556 | Not Available | 604 | Open in IMG/M |
| 3300009817|Ga0105062_1068692 | Not Available | 669 | Open in IMG/M |
| 3300010375|Ga0105239_13236515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 530 | Open in IMG/M |
| 3300010396|Ga0134126_11765381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 678 | Open in IMG/M |
| 3300010396|Ga0134126_12278770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 590 | Open in IMG/M |
| 3300010400|Ga0134122_10382577 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300011119|Ga0105246_10473052 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300012473|Ga0157340_1016317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 586 | Open in IMG/M |
| 3300012902|Ga0157291_10202052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 630 | Open in IMG/M |
| 3300012902|Ga0157291_10395348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 510 | Open in IMG/M |
| 3300012914|Ga0157297_10172306 | Not Available | 725 | Open in IMG/M |
| 3300012915|Ga0157302_10046266 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300012958|Ga0164299_10439341 | Not Available | 850 | Open in IMG/M |
| 3300012961|Ga0164302_10059966 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300012961|Ga0164302_10939275 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012986|Ga0164304_10179157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1364 | Open in IMG/M |
| 3300013296|Ga0157374_12748600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 520 | Open in IMG/M |
| 3300013308|Ga0157375_12772439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 586 | Open in IMG/M |
| 3300014326|Ga0157380_10970425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 881 | Open in IMG/M |
| 3300014968|Ga0157379_11552816 | Not Available | 645 | Open in IMG/M |
| 3300014969|Ga0157376_10225935 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300015077|Ga0173483_10106558 | Not Available | 1177 | Open in IMG/M |
| 3300015371|Ga0132258_11348885 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300015372|Ga0132256_100693443 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300015372|Ga0132256_102668300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 599 | Open in IMG/M |
| 3300015374|Ga0132255_101201279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300017792|Ga0163161_11293819 | Not Available | 634 | Open in IMG/M |
| 3300018001|Ga0187815_10266739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 725 | Open in IMG/M |
| 3300018007|Ga0187805_10544728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 546 | Open in IMG/M |
| 3300018007|Ga0187805_10650304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 500 | Open in IMG/M |
| 3300018017|Ga0187872_10291782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 716 | Open in IMG/M |
| 3300018078|Ga0184612_10254351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 907 | Open in IMG/M |
| 3300019356|Ga0173481_10402415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 670 | Open in IMG/M |
| 3300021855|Ga0213854_1381286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 540 | Open in IMG/M |
| 3300025898|Ga0207692_10707982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 654 | Open in IMG/M |
| 3300025899|Ga0207642_10058180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1782 | Open in IMG/M |
| 3300025903|Ga0207680_10968665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 609 | Open in IMG/M |
| 3300025915|Ga0207693_11309660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 542 | Open in IMG/M |
| 3300025945|Ga0207679_11871114 | Not Available | 548 | Open in IMG/M |
| 3300025960|Ga0207651_11579292 | Not Available | 591 | Open in IMG/M |
| 3300025981|Ga0207640_12052910 | Not Available | 518 | Open in IMG/M |
| 3300026053|Ga0208422_1023994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 725 | Open in IMG/M |
| 3300026118|Ga0207675_100912807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 895 | Open in IMG/M |
| 3300026118|Ga0207675_101378618 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027568|Ga0208042_1057279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 995 | Open in IMG/M |
| 3300027625|Ga0208044_1009643 | Not Available | 3773 | Open in IMG/M |
| 3300027641|Ga0208827_1062612 | Not Available | 1203 | Open in IMG/M |
| 3300027873|Ga0209814_10482736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 548 | Open in IMG/M |
| 3300028597|Ga0247820_10504492 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300030988|Ga0308183_1096660 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300030990|Ga0308178_1034042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 885 | Open in IMG/M |
| 3300031081|Ga0308185_1033274 | Not Available | 629 | Open in IMG/M |
| 3300031124|Ga0308151_1011791 | Not Available | 817 | Open in IMG/M |
| 3300031125|Ga0308182_1002990 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300031125|Ga0308182_1014500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 632 | Open in IMG/M |
| 3300031331|Ga0307432_1048973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1350 | Open in IMG/M |
| 3300031505|Ga0308150_1031244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 597 | Open in IMG/M |
| 3300031720|Ga0307469_12128886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 546 | Open in IMG/M |
| 3300031847|Ga0310907_10170575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1017 | Open in IMG/M |
| 3300031854|Ga0310904_11362258 | Not Available | 515 | Open in IMG/M |
| 3300031965|Ga0326597_11868032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 561 | Open in IMG/M |
| 3300031965|Ga0326597_11949167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 545 | Open in IMG/M |
| 3300032013|Ga0310906_10896462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 632 | Open in IMG/M |
| 3300032075|Ga0310890_10733051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 777 | Open in IMG/M |
| 3300032180|Ga0307471_101302783 | Not Available | 889 | Open in IMG/M |
| 3300032515|Ga0348332_13177043 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032515|Ga0348332_14705482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 576 | Open in IMG/M |
| 3300032515|Ga0348332_14706215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1280 | Open in IMG/M |
| 3300033521|Ga0316616_102110306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 749 | Open in IMG/M |
| 3300033551|Ga0247830_10673387 | Not Available | 821 | Open in IMG/M |
| 3300034644|Ga0370548_010181 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300034681|Ga0370546_084867 | Not Available | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300003287 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 83 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031331 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-150 | Environmental | Open in IMG/M |
| 3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_5913380 | 2032320005 | Soil | WQKMLNTMTCQAEEVRALMTKVAVTTGEPVTEQVRRGVDELRKAT |
| F14TC_1003153715 | 3300000559 | Soil | AYWQKLLSTLTSQAEEVRALATKMAAAASQPLKEQVKQGVDELRKAN* |
| JGI12270J11330_100131511 | 3300000567 | Peatlands Soil | TSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN* |
| JGI24033J26618_10695882 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | TSQAEEVRALSTKVAAAAGERSAHVKRGMDELRKVT* |
| Ga0006882J48912_1077881 | 3300003287 | Peatlands Soil | QKLCGNLTSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN* |
| Ga0055455_100547271 | 3300003990 | Natural And Restored Wetlands | LQVAYWQKLWGTFSSQAEEVRAVVTKVAAAVGEPLKEQVKRSVDDLRKAT* |
| Ga0068868_1020656762 | 3300005338 | Miscanthus Rhizosphere | WQKQLGALTSQAEEVRALSTKVAAAAGEPLKEQVKRGMDELRKAN* |
| Ga0070667_1015629561 | 3300005367 | Switchgrass Rhizosphere | MELQGAYWRKQLGALAAQAEEVRALSTKMAAAASEPPKEQVKRGAEELHKAN* |
| Ga0070714_1005894531 | 3300005435 | Agricultural Soil | WQKLLNTLTSQAEELRALATKMAAAASQPLKEQVKRGVDELGKVN* |
| Ga0068853_1002854085 | 3300005539 | Corn Rhizosphere | ALTSQAEEVRALSTKVAAAAGEPLKAHVKRGMDELRKVT* |
| Ga0068853_1005879911 | 3300005539 | Corn Rhizosphere | QKLLGTLTSQAEEVRALATKMAAAAIEPVKQQVKRGVDELGKVN* |
| Ga0068858_1018254012 | 3300005842 | Switchgrass Rhizosphere | LQGAYWRKQFGALAAQAEEVRALSTEMAAPASEPLKEQVKRGAEELHKANWLASA* |
| Ga0075432_105966991 | 3300006058 | Populus Rhizosphere | WQKQLGALTSQAEEVRALSTKVAAAAGEPLKEQMKRGMGELRKAN* |
| Ga0075421_1018708601 | 3300006845 | Populus Rhizosphere | HAAHWQKQLGALTSQAEEVRALSTKVAAAAGEPLKAHVKRGMDELRKVT* |
| Ga0068865_1013171801 | 3300006881 | Miscanthus Rhizosphere | TSQAEEVRALSTKMAAAAGEPLKQQMKRGVDDLRKSN* |
| Ga0075435_1002622311 | 3300007076 | Populus Rhizosphere | YWQKLLGTLTSQAEEVRALATKMAAAAIEPVKQQVKRGVDELGKVN* |
| Ga0075435_1010176511 | 3300007076 | Populus Rhizosphere | TSQAEEVRALSTKVAAAAGEPLKEQMKRGMGELRKAN* |
| Ga0105251_106142792 | 3300009011 | Switchgrass Rhizosphere | YWRKLFATLPSQAEELRTLLTKVVADAGQPLKEQVKRGVDKLGKVH* |
| Ga0105091_102547891 | 3300009146 | Freshwater Sediment | HWQNQIGALTAQAEEVSALSNKVAPAAGAPLEEQVKRGVETLAGGA* |
| Ga0114129_115200633 | 3300009147 | Populus Rhizosphere | LGALTSQAEEVRALSTKVAAAAGEPLKAQAKRSMDELRKAT* |
| Ga0114129_116990461 | 3300009147 | Populus Rhizosphere | WQKQLGALTSQAEEVRALSTKVAAAAGEPLKAHVKRGMDELRKVT* |
| Ga0114129_127535132 | 3300009147 | Populus Rhizosphere | DYWQKLLGALTSQAEEVRALSTKMAAAAGEPLKEQMKRRVDDLRKSN* |
| Ga0111538_129757182 | 3300009156 | Populus Rhizosphere | LWGTLTSQADEVRALSAKVAAAAGEPLKEQVKRGVDGLRKAN* |
| Ga0105104_106187252 | 3300009168 | Freshwater Sediment | LPSQAEEVHALANKMAAAASQPLKEQVKQGVDKLGKVI* |
| Ga0116214_12411712 | 3300009520 | Peatlands Soil | VDFEPGPVWQKLCGNLTSQAEEVRALSTKMAAAAGEPLKEQVK |
| Ga0116222_100534613 | 3300009521 | Peatlands Soil | VDFEPGPVWQKLCGNLTSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN* |
| Ga0116225_14468201 | 3300009524 | Peatlands Soil | SQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN* |
| Ga0105237_109731061 | 3300009545 | Corn Rhizosphere | LTSQAEEVRALSAKVAAAAGEPLKEQLKRGVNELHKAN* |
| Ga0105237_127066111 | 3300009545 | Corn Rhizosphere | ALTSQAEEVRALSAKVAAAAGEPLKEQLKRGVNELHKAN* |
| Ga0105249_118543123 | 3300009553 | Switchgrass Rhizosphere | QAEEVRALSTKMAAAAGEPLKEQMKRRVDDLRKSN* |
| Ga0105249_118793322 | 3300009553 | Switchgrass Rhizosphere | QAEEVRALSAKVAAAAGEPLKQQMKRGVDDLRKSN* |
| Ga0105252_104335562 | 3300009678 | Soil | YWQKLCGNLTSQAEEVRALSSKVTAAAGEQVKRGVDELRKAK* |
| Ga0105062_10686923 | 3300009817 | Groundwater Sand | AYWQKLLGALTSQAEEVRALSTKVAAAAGEPLKEQVKRGVDELRKAN* |
| Ga0105239_132365151 | 3300010375 | Corn Rhizosphere | QAEEVRALSTEMAAAASEPLKEQVKRGAEELHKAN* |
| Ga0134126_117653813 | 3300010396 | Terrestrial Soil | AAYWQKLLGALTSQAEEVRALSTKMAAAAGEPLKEQMKRRVDDLRKSN* |
| Ga0134126_122787701 | 3300010396 | Terrestrial Soil | AEEVRALSTKMAAAASEPPKEQVKRGAEELHKANWLASA* |
| Ga0134122_103825771 | 3300010400 | Terrestrial Soil | KLLGTLTSQAEEVRALATKMAAAAIEPVKQQVKRGVDELGKVN* |
| Ga0105246_104730524 | 3300011119 | Miscanthus Rhizosphere | QAAYWQKLLGTLVSQAEEVRALSTKVATAAGEPLKEQVKRGVDELHQSN* |
| Ga0157340_10163172 | 3300012473 | Arabidopsis Rhizosphere | LTSQAEEVRALSTKMAAAAVEPLKEQVKRGVDELRKAN* |
| Ga0157291_102020522 | 3300012902 | Soil | WQKQLGALTSQAEEVRALSTKVAAAAGEPLKAHVKRGMG* |
| Ga0157291_103953482 | 3300012902 | Soil | LQAAHWQKQLGALTSQAEEVRALSTKVAAAAGEPLKAQAKRSMDELRKVT* |
| Ga0157297_101723062 | 3300012914 | Soil | WPKLLGTLTSQVEEVRALATKMAAAAIEPVKQQVKRGVDELGKVN* |
| Ga0157302_100462661 | 3300012915 | Soil | KQLGALTSQAEEVRALSTKVAAAAGEPLKAHVKRGMDELRKVT* |
| Ga0164299_104393413 | 3300012958 | Soil | QAEEVRALSTKMAAAAVEPLKEQVKRGVDKLGKVH* |
| Ga0164302_100599661 | 3300012961 | Soil | KMLNTLTSQAEEVRALMKKVAVTTAEPVTEQVKRGVEQLRKAT* |
| Ga0164302_109392751 | 3300012961 | Soil | LQAAYWQKLLGALTSQAEEVRALSTKMAAAAVEPLKEQVKRGVNELRKAN* |
| Ga0164304_101791571 | 3300012986 | Soil | GAYWRKQLGALAAQAEEVRALSTKMAAAASEPPKEQVKRGAEELHKAN* |
| Ga0157374_127486002 | 3300013296 | Miscanthus Rhizosphere | ELQGAYWRKQFGALAAQAEEVRALSTEMAAPASEPLKEQVKRGAEELHKAN* |
| Ga0157375_127724392 | 3300013308 | Miscanthus Rhizosphere | AAHWQKQLGALTSQAEEVRALSTKVAAAAGEPLKEQVKRGMDELRKAN* |
| Ga0157380_109704251 | 3300014326 | Switchgrass Rhizosphere | RKLFATLPSQAEELRTLLTKVVADAGQPLKEQVKRGVDVLRKAN* |
| Ga0157379_115528162 | 3300014968 | Switchgrass Rhizosphere | VELQADYWQKLLGALTSQAEEVRALSTKMAAAAGEPLKQQMKRGVDDLRKSN* |
| Ga0157376_102259354 | 3300014969 | Miscanthus Rhizosphere | LGALTSQAEEVRALSTKVAAAAGEPLKEQVKRGMDELRKAN* |
| Ga0173483_101065583 | 3300015077 | Soil | YWQKLCGNLTSQAEEVRTLSSKVTAAAGEQVKRGVDELRKAK* |
| Ga0132258_113488851 | 3300015371 | Arabidopsis Rhizosphere | VELQAAHWQKQLGALTSQAEEVRALSTKVAAAAGEPLKEQVKRSVKAT* |
| Ga0132256_1006934431 | 3300015372 | Arabidopsis Rhizosphere | IEELQAAYWQELLGALTSQAEEVRALSTKMAAAAVEPLKEQVKRGVDELRKAN* |
| Ga0132256_1026683001 | 3300015372 | Arabidopsis Rhizosphere | AAHWQKQLGALTSQAEEVCALSTKVAAAAGEPLKEQVKRGMDELRKAN* |
| Ga0132255_1012012793 | 3300015374 | Arabidopsis Rhizosphere | DLYDRVKLQAAYWRKQFGVMTAQAEEVRALSVEVTAAAAAPLKAQVQRGVDELREAN* |
| Ga0163161_112938192 | 3300017792 | Switchgrass Rhizosphere | LGALTSQAEEVRALSTKMAAAAVEPLKEQVKRGVDKLGKVH |
| Ga0187815_102667392 | 3300018001 | Freshwater Sediment | AAYWQKLLGALTSQAEEVRALSTKMAAAAGEPLKEQVKRGVDQLRKAN |
| Ga0187805_105447282 | 3300018007 | Freshwater Sediment | ELQAAYWQKLLGALTSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN |
| Ga0187805_106503041 | 3300018007 | Freshwater Sediment | LGALTSQAEEVRALSTKMATVAGEPLKEQVKRGVDQLRKAN |
| Ga0187872_102917822 | 3300018017 | Peatland | KSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN |
| Ga0184612_102543512 | 3300018078 | Groundwater Sediment | MVELQAAYWQKLLGALTSQGEEVRALSAKVAVAAGEPLKEQVKRGVDDLRKAN |
| Ga0173481_104024152 | 3300019356 | Soil | LSTLTSQAEEVRALATKVAAAAGEPFKEQVNRVAELRKAN |
| Ga0213854_13812861 | 3300021855 | Watersheds | ELQAAYWQKLLGTLKSQAEEVRTLSTKLAAAAGEPLKEQVKRGVDTLRKAN |
| Ga0207692_107079821 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | HWQKQLGALTSQAEEVRALSTKVAAAAGEPLKEQVKRGMDELRKAN |
| Ga0207642_100581805 | 3300025899 | Miscanthus Rhizosphere | GALTSQAEEVRALSTKVAAAAGEPLKEQVKRGMDELRKAN |
| Ga0207680_109686652 | 3300025903 | Switchgrass Rhizosphere | IVELQAAHWQKQLGALTSQAEEVRALSTKVAAAAGEPLKAHVNAAWMSCAR |
| Ga0207693_113096601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QKQLGALTSQAEEIHALSTKVAAAAGEPLKEQVKRGMDELRKAT |
| Ga0207679_118711141 | 3300025945 | Corn Rhizosphere | LQLQGEYWQKLCGNLTSQAEEVRALSSKVTAAAGEQVKRGVDELRKAK |
| Ga0207651_115792922 | 3300025960 | Switchgrass Rhizosphere | QAEEVRALATKMAAAAIEPVKQQVKRGVDELGKVN |
| Ga0207640_120529102 | 3300025981 | Corn Rhizosphere | QVEEVRALATKMAAAAIEPVKQQVKRGVDELGKVN |
| Ga0208422_10239943 | 3300026053 | Natural And Restored Wetlands | PKPLRVRALSTKMAAAAGEPLKEQVKRSVDELRKAN |
| Ga0207675_1009128071 | 3300026118 | Switchgrass Rhizosphere | KLLGALTSQAEEVRALSAKVAAAAGEPLKEQVKRGVDEPRKAN |
| Ga0207675_1013786182 | 3300026118 | Switchgrass Rhizosphere | TSQAEEVRALSAKVAAAAGEPLKEQLKRGVNELHKAN |
| Ga0208042_10572793 | 3300027568 | Peatlands Soil | CGNLTSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN |
| Ga0208044_10096434 | 3300027625 | Peatlands Soil | VDFEPGPVWQKLCGNLTSQAEEVRALSTKMAAAAGEPLKEQVKRGVDEPRKAN |
| Ga0208827_10626123 | 3300027641 | Peatlands Soil | VDFEPGPVWQKLCGNLTSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN |
| Ga0209814_104827361 | 3300027873 | Populus Rhizosphere | YWQKLLGALTSQAEEVRALSTKMAAAAGEPLKQQMKRGVDDLRKSN |
| Ga0247820_105044922 | 3300028597 | Soil | AYWQKLLGTLVSQAEEVRALSTKVATAAGEPLKEQVKRGMDELRKAN |
| Ga0308183_10966601 | 3300030988 | Soil | ALTSQAEEVRALSAKVAAAAGEPLKEQLKRGVNELHKAN |
| Ga0308178_10340423 | 3300030990 | Soil | VELQAAYWQKLLGALTSQAEEVRALSAKLAAAAGEPLKEQVKRGVDELRKAN |
| Ga0308185_10332741 | 3300031081 | Soil | GAKNLPEILQLQGAYWQKLCGNLTSQAEEVRALSSKVTAAAGEQVKRGVDELRKVK |
| Ga0308151_10117912 | 3300031124 | Soil | VELQAAYWQKLLGALTSQAEEVRALSAKVAAAAGEPLKEQVKRGVDELRKAN |
| Ga0308182_10029903 | 3300031125 | Soil | LGALTSQAEEVRALSTKMAAAAVEPLKEQVKRGVNELRKAN |
| Ga0308182_10145001 | 3300031125 | Soil | QGAYWRKQFGALAAQAEEVRALSTKMAAAASEPLKEQVKRGVNEPRKAN |
| Ga0307432_10489732 | 3300031331 | Salt Marsh | MVELQAAYWQKLLGTLTSQVEEVRAFSTKMAAAAGEPLKEQVKRGVDELRKAN |
| Ga0308150_10312441 | 3300031505 | Soil | TSQAEEVRALSAKVAVAAGEPLKEQVKRGVDDLRKAN |
| Ga0307469_121288861 | 3300031720 | Hardwood Forest Soil | QWGTLTSQAEEVRALATKMAAAASQPLKEQMKQGVDALRKAN |
| Ga0310907_101705752 | 3300031847 | Soil | AYWQKLLGTLVSQAEEVRALSTKVATAAGEPLKEQMKRGVDDLRKLN |
| Ga0310904_113622581 | 3300031854 | Soil | AVYWQKLLGALTSQAEEVRALSAKVAAAAGEPLKEQLKRGVNELHKAN |
| Ga0326597_118680322 | 3300031965 | Soil | YWQKLLGTLTSQAEEVRAVATKVAATAGEPLKEQVKRSVDELRKAN |
| Ga0326597_119491671 | 3300031965 | Soil | LQAAYWQKLLGTLTSQAEEVRALSTKVAAAAGEPLKEQVQRGVDELRKAN |
| Ga0310906_108964623 | 3300032013 | Soil | WQKQLGALTSQAEEVRALSTKVAAAAGEPLKAHVKRGMDELRKVT |
| Ga0310890_107330511 | 3300032075 | Soil | WQKLLGALTSQAEEVRALSAKVAAAAGEPLKEQVKRGVDELRKAN |
| Ga0307471_1013027831 | 3300032180 | Hardwood Forest Soil | TSQAEEVRALSTKMAAAAGEPLKEQVKRGVEELRKAN |
| Ga0348332_131770431 | 3300032515 | Plant Litter | EMVELQAAYWQKLLGALKSQAEEVRALSTKMAAAAGEPLKEHMAGGADGLGTTH |
| Ga0348332_147054821 | 3300032515 | Plant Litter | QKLLGALKSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKAN |
| Ga0348332_147062154 | 3300032515 | Plant Litter | QKLLGALKSQAEEVRALSTKMAAAAGEPLKEQVKRGVDELRKTS |
| Ga0316616_1021103061 | 3300033521 | Soil | DYWQKLLGALTSQAEEVRALSTKMAAAAGEPLKQQMKRGVDDLRKSN |
| Ga0247830_106733873 | 3300033551 | Soil | AYWQQLCGNLTSQAEEVRALSNKVTADAGEQVKRGVDELRKAK |
| Ga0370548_010181_1112_1264 | 3300034644 | Soil | LQAVYWQKLLGALTSQAEEVRALSAKVAAAAGEPLKEQVKRGVNELRKAN |
| Ga0370546_084867_407_532 | 3300034681 | Soil | LGALTSQAEEIRAISTKVAAAAGEPLKEQVKRGVDELGKVH |
| ⦗Top⦘ |