


| Basic Information | |
|---|---|
| Family ID | F098780 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 42 residues |
| Representative Sequence | THEKGTLKGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 97.09 % |
| % of genes from short scaffolds (< 2000 bps) | 89.32 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.058 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (58.252 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.340 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.194 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 35.21% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF10079 | BshC | 4.85 |
| PF10127 | RlaP | 4.85 |
| PF02472 | ExbD | 2.91 |
| PF01381 | HTH_3 | 2.91 |
| PF13505 | OMP_b-brl | 1.94 |
| PF02585 | PIG-L | 0.97 |
| PF00793 | DAHP_synth_1 | 0.97 |
| PF12732 | YtxH | 0.97 |
| PF01546 | Peptidase_M20 | 0.97 |
| PF13646 | HEAT_2 | 0.97 |
| PF06123 | CreD | 0.97 |
| PF00266 | Aminotran_5 | 0.97 |
| PF01740 | STAS | 0.97 |
| PF03069 | FmdA_AmdA | 0.97 |
| PF13372 | Alginate_exp | 0.97 |
| PF00480 | ROK | 0.97 |
| PF02133 | Transp_cyt_pur | 0.97 |
| PF02786 | CPSase_L_D2 | 0.97 |
| PF02518 | HATPase_c | 0.97 |
| PF08241 | Methyltransf_11 | 0.97 |
| PF00441 | Acyl-CoA_dh_1 | 0.97 |
| PF12844 | HTH_19 | 0.97 |
| PF13419 | HAD_2 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 2.91 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.94 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.97 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.97 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.97 |
| COG4452 | Inner membrane protein CreD involved in colicin E2 resistance | Defense mechanisms [V] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.06 % |
| Unclassified | root | N/A | 1.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig89168.52893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104865743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300001661|JGI12053J15887_10266817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300002914|JGI25617J43924_10102097 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300005437|Ga0070710_10098752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1735 | Open in IMG/M |
| 3300005537|Ga0070730_10356921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300005586|Ga0066691_10795103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 558 | Open in IMG/M |
| 3300006914|Ga0075436_100159529 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300007258|Ga0099793_10267562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300007788|Ga0099795_10077837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300007819|Ga0104322_142691 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300009038|Ga0099829_10425534 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300009088|Ga0099830_10413872 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300009088|Ga0099830_11763185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300009089|Ga0099828_11322775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 637 | Open in IMG/M |
| 3300010048|Ga0126373_11385768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300010082|Ga0127469_141315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 624 | Open in IMG/M |
| 3300010159|Ga0099796_10133932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300010337|Ga0134062_10470550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 627 | Open in IMG/M |
| 3300010360|Ga0126372_11485504 | Not Available | 713 | Open in IMG/M |
| 3300010362|Ga0126377_12171604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300011269|Ga0137392_10380250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300011269|Ga0137392_11455522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300011270|Ga0137391_10433130 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300011270|Ga0137391_11243860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300011271|Ga0137393_10460941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300012189|Ga0137388_10413514 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300012189|Ga0137388_11809035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012189|Ga0137388_11812313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300012198|Ga0137364_10357053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300012200|Ga0137382_10415589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300012202|Ga0137363_10551555 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012203|Ga0137399_10344112 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300012203|Ga0137399_10370394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
| 3300012208|Ga0137376_11265972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 627 | Open in IMG/M |
| 3300012361|Ga0137360_10239007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300012362|Ga0137361_10228557 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300012582|Ga0137358_10220366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300012685|Ga0137397_11247578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300012917|Ga0137395_10518927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300012918|Ga0137396_10652273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300012918|Ga0137396_11137240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 555 | Open in IMG/M |
| 3300012923|Ga0137359_11230318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300012924|Ga0137413_10615501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300012924|Ga0137413_11382310 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012925|Ga0137419_10054131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2601 | Open in IMG/M |
| 3300012925|Ga0137419_10623290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 868 | Open in IMG/M |
| 3300012925|Ga0137419_11962477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 503 | Open in IMG/M |
| 3300012927|Ga0137416_10475574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300012927|Ga0137416_12247003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300012929|Ga0137404_11310344 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012944|Ga0137410_11348596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 618 | Open in IMG/M |
| 3300015053|Ga0137405_1393116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6261 | Open in IMG/M |
| 3300015054|Ga0137420_1233036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1445 | Open in IMG/M |
| 3300015242|Ga0137412_10257916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300015242|Ga0137412_10259683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1372 | Open in IMG/M |
| 3300020140|Ga0179590_1005212 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300020140|Ga0179590_1142371 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300020170|Ga0179594_10347626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 562 | Open in IMG/M |
| 3300020199|Ga0179592_10057300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1776 | Open in IMG/M |
| 3300020199|Ga0179592_10236450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300020199|Ga0179592_10295728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300020199|Ga0179592_10307667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300021088|Ga0210404_10004679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5495 | Open in IMG/M |
| 3300021088|Ga0210404_10349574 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300021178|Ga0210408_10105602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2214 | Open in IMG/M |
| 3300021178|Ga0210408_10658951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300021407|Ga0210383_10415300 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300021420|Ga0210394_11723656 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021432|Ga0210384_10268031 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300021559|Ga0210409_10483367 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300024288|Ga0179589_10185445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300026328|Ga0209802_1225231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300026332|Ga0209803_1256520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 602 | Open in IMG/M |
| 3300026537|Ga0209157_1143204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300026551|Ga0209648_10109195 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300026551|Ga0209648_10117956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2147 | Open in IMG/M |
| 3300026551|Ga0209648_10181630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1627 | Open in IMG/M |
| 3300027643|Ga0209076_1075333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300027655|Ga0209388_1098900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300027660|Ga0209736_1206666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027846|Ga0209180_10101677 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300027846|Ga0209180_10459965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300027846|Ga0209180_10768514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300027862|Ga0209701_10215592 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300027875|Ga0209283_10131210 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300027875|Ga0209283_10810112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300027903|Ga0209488_10114212 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300027903|Ga0209488_10224300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
| 3300027910|Ga0209583_10783263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300028047|Ga0209526_10460115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300031231|Ga0170824_120403550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300031718|Ga0307474_10445738 | Not Available | 1011 | Open in IMG/M |
| 3300031720|Ga0307469_10380197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1197 | Open in IMG/M |
| 3300031720|Ga0307469_10422741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300031754|Ga0307475_10090515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2372 | Open in IMG/M |
| 3300031754|Ga0307475_10487086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300031962|Ga0307479_10106162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2731 | Open in IMG/M |
| 3300031962|Ga0307479_10409622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1340 | Open in IMG/M |
| 3300031962|Ga0307479_10975358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 818 | Open in IMG/M |
| 3300032059|Ga0318533_11230018 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032174|Ga0307470_11324015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 591 | Open in IMG/M |
| 3300032180|Ga0307471_100775315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 58.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00716910 | 2199352024 | Soil | VTGATHEKGKQKGKAYEHYGRFTDTWIKHDSQWICVSSQLGLLHK |
| INPhiseqgaiiFebDRAFT_1048657431 | 3300000364 | Soil | QNGKPFAHNGRSTDTWIKKDGRWVCVASHLGVISK* |
| JGI12053J15887_102668171 | 3300001661 | Forest Soil | KGTFKGKPYQHQGRFTDTWMKKNGQWLCIASHLGVVSK* |
| JGI25617J43924_101020971 | 3300002914 | Grasslands Soil | GATHEKGTEKGKPFSHVGRFTDTWIKKDGQWLCIASQLSLIGK* |
| Ga0070710_100987521 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | HEKGKQRGKTYEHYGRFTDTWIRHNREWICVASHLGLLQK* |
| Ga0070730_103569211 | 3300005537 | Surface Soil | ATHERGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALMPKSL* |
| Ga0066691_107951032 | 3300005586 | Soil | KGKPYAHQGRFTDTWIKKDSQWLCFASQLSLIGK* |
| Ga0075436_1001595293 | 3300006914 | Populus Rhizosphere | VYHEKGTLNGKPYYHHGRFTDTWIKEGSAWLCAASQSTLIQK* |
| Ga0099793_102675621 | 3300007258 | Vadose Zone Soil | TEKGKPYAHQGRFTDTWIKKDGQWLCVASQLSLISSK* |
| Ga0099795_100778371 | 3300007788 | Vadose Zone Soil | TVVVIGATHEKGTAKGKPYEHYGRFTDTWIKRDAQWLCVASQLALIPKSL* |
| Ga0104322_1426911 | 3300007819 | Permafrost Soil | VTGATHEKGTNKGKHYEHRGRFTDTWILKNGEWLCVASHLGLLSK* |
| Ga0099829_104255342 | 3300009038 | Vadose Zone Soil | LKGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL* |
| Ga0099830_104138721 | 3300009088 | Vadose Zone Soil | IGATHEKGALKGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL* |
| Ga0099830_117631851 | 3300009088 | Vadose Zone Soil | TLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL* |
| Ga0099828_113227752 | 3300009089 | Vadose Zone Soil | GTEKGKPFSHQGRFTDTWIKKDGQWLCIASQLSLISK* |
| Ga0126373_113857682 | 3300010048 | Tropical Forest Soil | VVVTGATHEKGTLKGKPYEHYGRFTDTWIKQNGEWICVASQLGLLRSVG* |
| Ga0127469_1413151 | 3300010082 | Grasslands Soil | VTGATREKGTEKGKPYAHQGRFTETWIKKDRQWLCVASQPSLIGK* |
| Ga0099796_101339321 | 3300010159 | Vadose Zone Soil | THEKGTAKGKPYEHYGRFTDTWIKRDTQWLCVASQLALIPKSL* |
| Ga0134062_104705501 | 3300010337 | Grasslands Soil | KGTEKGKPFSHHGRFTDTWIKKDGQWLCIASQLSLIGK* |
| Ga0126372_114855041 | 3300010360 | Tropical Forest Soil | LKGKAYQHQGRFTDTWIKKNGQWLCVASQLSSVGK* |
| Ga0126377_121716041 | 3300010362 | Tropical Forest Soil | KGTQNGKPFAHTGRFTDTWIKKNGTWLCVASHLGVVSK* |
| Ga0137392_103802501 | 3300011269 | Vadose Zone Soil | YEHHGRFTDTWIKRDYRWLCIASQLAQIPVIRGG* |
| Ga0137392_114555222 | 3300011269 | Vadose Zone Soil | VIGATHEKGAAKGKPYEHYGRFTDTWIKRDSQWLCIASQLSLVPKSL* |
| Ga0137391_104331303 | 3300011270 | Vadose Zone Soil | GDTVIVIGATHEKGALRSKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL* |
| Ga0137391_112438602 | 3300011270 | Vadose Zone Soil | GKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL* |
| Ga0137393_104609411 | 3300011271 | Vadose Zone Soil | IVIGSTREKGTEKGKPFSHLGRFTDTWNKKDGQWLCIASQLSLIGK* |
| Ga0137388_104135141 | 3300012189 | Vadose Zone Soil | ATHERGTLRGKPYEHYGRFTDTWIKHDAQWLCIASQLALIPKPL* |
| Ga0137388_118090351 | 3300012189 | Vadose Zone Soil | GSTHEKGTEKGKPFVHRGRFTDTWIKKDGQWLCVASQLSLLNK* |
| Ga0137388_118123131 | 3300012189 | Vadose Zone Soil | TVVVIGATHEKGALKGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL* |
| Ga0137364_103570531 | 3300012198 | Vadose Zone Soil | VVTGATREKGTEKGKPYAHQGRFTDTWTKKDGQWLCVAVS* |
| Ga0137382_104155892 | 3300012200 | Vadose Zone Soil | MELHRHGDTVAVTGATREKGTEKGKPYAHQGRFTETWIKKDRQWLCVASQPSLIGK* |
| Ga0137363_105515552 | 3300012202 | Vadose Zone Soil | THEKGTLKGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL* |
| Ga0137399_103441121 | 3300012203 | Vadose Zone Soil | KGKPYEHYGRFTDTWIKRDAQWLCVASQLALIPKSL* |
| Ga0137399_103703941 | 3300012203 | Vadose Zone Soil | THEKGTAKGKPYEHYGRFTDTWIKREAQWLCVASQLALIPKSL* |
| Ga0137376_112659722 | 3300012208 | Vadose Zone Soil | GATREKGTEKGKPYAHQGRFTETWIKKDRQWLCVASQPSLIGK* |
| Ga0137360_102390072 | 3300012361 | Vadose Zone Soil | GATHEKGTAKGKPYEHHGRFTDTWIKRDAQWLCIASQLSLIPKSL* |
| Ga0137361_102285571 | 3300012362 | Vadose Zone Soil | GTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL* |
| Ga0137358_102203662 | 3300012582 | Vadose Zone Soil | VIGATHEKGTAKGKPYEHYGRFTDTWIKRDAQWLCVASQLALIPKSL* |
| Ga0137397_112475781 | 3300012685 | Vadose Zone Soil | IIIGATHEKGTAKGKPYEHYGRFTDTWIKRDDRWLCIASQLALIPKSV* |
| Ga0137395_105189271 | 3300012917 | Vadose Zone Soil | ATHEKGTAKGKPYEHYGRFTDTWIKRDAQWLCIASQLSLIPKSL* |
| Ga0137396_106522732 | 3300012918 | Vadose Zone Soil | VTGATREKGTEKGKPYAHQGRFTDTWIKKDGQWLCVASQLSLISSK* |
| Ga0137396_111372402 | 3300012918 | Vadose Zone Soil | GTEQGTPYAHQGRFTATSIKKDGQWLCVASQLSLTSSK* |
| Ga0137359_112303181 | 3300012923 | Vadose Zone Soil | ATHEKGTAKGKPYEHYGRFTDTWIKREPQWLCVASQLALIPKSL* |
| Ga0137413_106155011 | 3300012924 | Vadose Zone Soil | GTEKGKPFSHLGRFTDTWIKKDGQWLCIASQLSLIGK* |
| Ga0137413_113823101 | 3300012924 | Vadose Zone Soil | EKGTAKGKPYEHHGRFTDTWIKRDDRWLCVASQLALIPKSL* |
| Ga0137419_100541311 | 3300012925 | Vadose Zone Soil | KGKPFSHLGRFTDTWIKKDGQWLCIASQLSLIGK* |
| Ga0137419_106232901 | 3300012925 | Vadose Zone Soil | EKGTAKGKPYAHQGRFTDTWIKKDGQWLCVASQLSLIGK* |
| Ga0137419_119624771 | 3300012925 | Vadose Zone Soil | EKGTFKGKPYQHQGRFTDTWIKKNGQWLCIASHLGVVSK* |
| Ga0137416_104755741 | 3300012927 | Vadose Zone Soil | TVVVTGATREKGTEKGKPYAHQGRFTDTWIKKDSQWLCVASQLSLINK* |
| Ga0137416_122470032 | 3300012927 | Vadose Zone Soil | IGATHEKGTAKGRPYEHHGRFTDTWIKRDAQWLCIASQLALIPKSL* |
| Ga0137404_113103441 | 3300012929 | Vadose Zone Soil | GKPYEHYGRFTDTWIKREAQWLCVASQLALIPKSL* |
| Ga0137410_113485962 | 3300012944 | Vadose Zone Soil | KGTFKGKPYQHQGRFTDTWMKKNGQWLCIASHLGVISKPA* |
| Ga0137405_13931165 | 3300015053 | Vadose Zone Soil | MKLHRHGDTVVVIGATHEKGTFKGKPYQHQGGFTDTWMKKNGQWLCIASHLGVTSK* |
| Ga0137420_12330362 | 3300015054 | Vadose Zone Soil | KGTEKGKSFSHVGRFTDTWIKKDGKWLCIASQLSLIGK* |
| Ga0137412_102579161 | 3300015242 | Vadose Zone Soil | HEKGTAKGKPYEHYGRFTDTWIKRDAQWLCVASQLALIPKSL* |
| Ga0137412_102596831 | 3300015242 | Vadose Zone Soil | HEKGTAKGKPYEHYGRFTDTWIKRDTQWLCVASQLALIPKSV* |
| Ga0179590_10052124 | 3300020140 | Vadose Zone Soil | TVVVIGATHEKGTAKGKPYEHHGRFTDTWIKRDDRWLCVASQLALTPKSV |
| Ga0179590_11423712 | 3300020140 | Vadose Zone Soil | KGTAKGKPYEHYGRFTDTWIKREAQWLCVASQLALIPKSL |
| Ga0179594_103476262 | 3300020170 | Vadose Zone Soil | GTAKGKPYAHQGRFTDTWIKKDGQWLCVASQLSLIGK |
| Ga0179592_100573003 | 3300020199 | Vadose Zone Soil | KGTAKGKPYEHYGRFTDTWIKRDAQWLCVASQLALIPKSL |
| Ga0179592_102364502 | 3300020199 | Vadose Zone Soil | STHEKGTEKGKPFSHAGRFTDTWIKKDGQWLCIASQLSLIGK |
| Ga0179592_102957282 | 3300020199 | Vadose Zone Soil | VVVIGATHEKGTLKGKQYQHNGRFTDTWIKRDNQWLCIASQLSLIPKSL |
| Ga0179592_103076672 | 3300020199 | Vadose Zone Soil | ATHEKGTAKGKPYEHYGRFTDTWIKRDTQWLCVASQLALIPKSL |
| Ga0210404_100046791 | 3300021088 | Soil | KGKPYEHHGRFTDTWIKHDSQWLCVASQLSLIPKSL |
| Ga0210404_103495741 | 3300021088 | Soil | KGILKGKPYEHHGRFTDTWIKHDSQWLCVASQLSLIPKSL |
| Ga0210408_101056021 | 3300021178 | Soil | VGATHEKGTAKGKPYEHHGRFTDTWIKRDYRWLCIASQLSLIPKSQ |
| Ga0210408_106589511 | 3300021178 | Soil | KGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| Ga0210383_104153001 | 3300021407 | Soil | HEKGTEKGKAFSHSGRFTDTWIKKDGQWLCVASQLSLLGK |
| Ga0210394_117236561 | 3300021420 | Soil | VIGATREKGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| Ga0210384_102680311 | 3300021432 | Soil | EKGTLKGKPYEHHGRFTDTWTKHDGQWLCIASHLSLIPKT |
| Ga0210409_104833671 | 3300021559 | Soil | TREKGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| Ga0179589_101854453 | 3300024288 | Vadose Zone Soil | HEKGTAKGKPYEHYGRFTDTWIKRDTQWLCVASQLALIPKSL |
| Ga0209802_12252311 | 3300026328 | Soil | TREKGTEKGKPFSHLGRFTDTWIKKDGQWLCIASQLSLIGK |
| Ga0209803_12565201 | 3300026332 | Soil | TVVVIGATHEKGTEKGKPFSHHGRFTDTWIKKDGQWLCIASQLSLIGK |
| Ga0209157_11432042 | 3300026537 | Soil | TVIVIGSTREKGTEKGKPFSHLGRFTDTWIKKDGQWLCIASQLSLIGK |
| Ga0209648_101091953 | 3300026551 | Grasslands Soil | EKGTEKGKLFSHLGRFTDTWIKKDGQWLCIASQLSLIGK |
| Ga0209648_101179561 | 3300026551 | Grasslands Soil | IGATHEKGTLKGKPYEHNGRFTDTWIKRDYRWLCVASQLAIIPKSL |
| Ga0209648_101816303 | 3300026551 | Grasslands Soil | VVVTGATREKGTENGKPYAHQGRFTDTWIKKDGQWLCVASQLRLIGK |
| Ga0209076_10753332 | 3300027643 | Vadose Zone Soil | EKGTEKGKPFSHLGRFTDTWIKKDGQWLCIASQLSLIGK |
| Ga0209388_10989002 | 3300027655 | Vadose Zone Soil | VIVIGSTREKGTEKGKPFSHLGRFTDTWIKKDGQWLCIASQLSLIGK |
| Ga0209736_12066661 | 3300027660 | Forest Soil | LKGKPYEHHGRFTDTWIRRDYRWLCIASQLALIPKSL |
| Ga0209180_101016771 | 3300027846 | Vadose Zone Soil | GATHEKGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| Ga0209180_104599651 | 3300027846 | Vadose Zone Soil | VIVIGATHEKGTLKGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL |
| Ga0209180_107685142 | 3300027846 | Vadose Zone Soil | VVVTGATHEKGALKGKAYEHYGRFTDTWIKRDGQWICVASQLGLLQK |
| Ga0209701_102155921 | 3300027862 | Vadose Zone Soil | THEKGALKGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL |
| Ga0209283_101312101 | 3300027875 | Vadose Zone Soil | ATREKGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| Ga0209283_108101121 | 3300027875 | Vadose Zone Soil | KGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKSL |
| Ga0209488_101142121 | 3300027903 | Vadose Zone Soil | VVVIGATHEKGTAKGKPYEHYGRFTDTWIKRDDRWLCVASQLALIPKSV |
| Ga0209488_102243001 | 3300027903 | Vadose Zone Soil | VVVIGATHEKGTAKGKPYEHYGRFTDTWIKRDAQWLCVASQLALIPKSL |
| Ga0209583_107832631 | 3300027910 | Watersheds | DTVVVTGATHEKGKQIGKTYEHYGRFTDTWIRRNSEWICVASHLGLLQK |
| Ga0209526_104601153 | 3300028047 | Forest Soil | TLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| Ga0170824_1204035501 | 3300031231 | Forest Soil | HEKGKQKGKAYEHYGRFTDTWIKHDSEWICVASHLGLLHN |
| Ga0307474_104457381 | 3300031718 | Hardwood Forest Soil | HEKGKQKGKTYEHYGRFTDTWMRRNNEWICVASQLGLLPK |
| Ga0307469_103801971 | 3300031720 | Hardwood Forest Soil | KGTLRGKPYEHHGRFTDTWIKRDYRWLCVASQLALIPKPL |
| Ga0307469_104227411 | 3300031720 | Hardwood Forest Soil | TFKGKPYQHQGRFTDTWMKKNGQWLCIASHLSAISKPA |
| Ga0307475_100905154 | 3300031754 | Hardwood Forest Soil | REKGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKTL |
| Ga0307475_104870863 | 3300031754 | Hardwood Forest Soil | VIVIGATHEKGTLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| Ga0307479_101061621 | 3300031962 | Hardwood Forest Soil | KGTLKGKTYQHKGRFTDTWIRQDGRWICVASQLALLSN |
| Ga0307479_104096221 | 3300031962 | Hardwood Forest Soil | IGATHEKGTENGKAFSHHGRFTDTWIKKDGQWLCIASQLSLVGK |
| Ga0307479_109753582 | 3300031962 | Hardwood Forest Soil | TLKGKPYEHHGRFTDTWIKRDYRWLCIASQLALIPKTL |
| Ga0318533_112300181 | 3300032059 | Soil | VVTGATHEKGKQRGKTYEHYGRFTDTWVKQNGAWICVASQLGLLQK |
| Ga0307470_113240152 | 3300032174 | Hardwood Forest Soil | ATHEKGTFKGKPYQHQGRFTDTWIKKNGQCLCVASHLSAISKPA |
| Ga0307471_1007753151 | 3300032180 | Hardwood Forest Soil | LKGKRYEHHGRFTDTWIKRDYRWLCIASQLALIPKSL |
| ⦗Top⦘ |