NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F098610

Metatranscriptome Family F098610

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098610
Family Type Metatranscriptome
Number of Sequences 103
Average Sequence Length 102 residues
Representative Sequence MFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Number of Associated Samples 95
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 34.95 %
% of genes near scaffold ends (potentially truncated) 42.72 %
% of genes from short scaffolds (< 2000 bps) 99.03 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(78.641 % of family members)
Environment Ontology (ENVO) Unclassified
(96.117 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.466 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 7.69%    β-sheet: 44.23%    Coil/Unstructured: 48.08%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10461043All Organisms → cellular organisms → Eukaryota684Open in IMG/M
3300008998|Ga0103502_10113353All Organisms → cellular organisms → Eukaryota970Open in IMG/M
3300008998|Ga0103502_10190246All Organisms → cellular organisms → Eukaryota749Open in IMG/M
3300009022|Ga0103706_10002948All Organisms → cellular organisms → Eukaryota2211Open in IMG/M
3300009028|Ga0103708_100023935All Organisms → cellular organisms → Eukaryota1173Open in IMG/M
3300010985|Ga0138326_10294887All Organisms → cellular organisms → Eukaryota707Open in IMG/M
3300010987|Ga0138324_10308004All Organisms → cellular organisms → Eukaryota759Open in IMG/M
3300018534|Ga0193486_105560All Organisms → cellular organisms → Eukaryota725Open in IMG/M
3300018590|Ga0193114_1022507All Organisms → cellular organisms → Eukaryota621Open in IMG/M
3300018612|Ga0193121_1049198All Organisms → cellular organisms → Eukaryota521Open in IMG/M
3300018626|Ga0192863_1027181All Organisms → cellular organisms → Eukaryota719Open in IMG/M
3300018639|Ga0192864_1031971All Organisms → cellular organisms → Eukaryota774Open in IMG/M
3300018648|Ga0193445_1045297All Organisms → cellular organisms → Eukaryota561Open in IMG/M
3300018658|Ga0192906_1038624All Organisms → cellular organisms → Eukaryota532Open in IMG/M
3300018664|Ga0193401_1033336All Organisms → cellular organisms → Eukaryota675Open in IMG/M
3300018677|Ga0193404_1017467All Organisms → cellular organisms → Eukaryota991Open in IMG/M
3300018685|Ga0193086_1013964All Organisms → cellular organisms → Eukaryota1191Open in IMG/M
3300018686|Ga0192840_1014770All Organisms → cellular organisms → Eukaryota896Open in IMG/M
3300018700|Ga0193403_1038536All Organisms → cellular organisms → Eukaryota718Open in IMG/M
3300018704|Ga0192954_1029562All Organisms → cellular organisms → Eukaryota718Open in IMG/M
3300018706|Ga0193539_1034521All Organisms → cellular organisms → Eukaryota861Open in IMG/M
3300018707|Ga0192876_1042235All Organisms → cellular organisms → Eukaryota787Open in IMG/M
3300018708|Ga0192920_1052021All Organisms → cellular organisms → Eukaryota728Open in IMG/M
3300018709|Ga0193209_1052775All Organisms → cellular organisms → Eukaryota577Open in IMG/M
3300018711|Ga0193069_1049541All Organisms → cellular organisms → Eukaryota514Open in IMG/M
3300018711|Ga0193069_1049750All Organisms → cellular organisms → Eukaryota513Open in IMG/M
3300018715|Ga0193537_1055299All Organisms → cellular organisms → Eukaryota825Open in IMG/M
3300018733|Ga0193036_1017020All Organisms → cellular organisms → Eukaryota906Open in IMG/M
3300018737|Ga0193418_1039728All Organisms → cellular organisms → Eukaryota805Open in IMG/M
3300018748|Ga0193416_1033059All Organisms → cellular organisms → Eukaryota865Open in IMG/M
3300018756|Ga0192931_1097596All Organisms → cellular organisms → Eukaryota533Open in IMG/M
3300018767|Ga0193212_1043368All Organisms → cellular organisms → Eukaryota672Open in IMG/M
3300018767|Ga0193212_1049583All Organisms → cellular organisms → Eukaryota630Open in IMG/M
3300018769|Ga0193478_1018606All Organisms → cellular organisms → Eukaryota1060Open in IMG/M
3300018793|Ga0192928_1032690All Organisms → cellular organisms → Eukaryota936Open in IMG/M
3300018793|Ga0192928_1032692All Organisms → cellular organisms → Eukaryota936Open in IMG/M
3300018793|Ga0192928_1033109All Organisms → cellular organisms → Eukaryota930Open in IMG/M
3300018795|Ga0192865_10034103All Organisms → cellular organisms → Eukaryota884Open in IMG/M
3300018796|Ga0193117_1060211All Organisms → cellular organisms → Eukaryota629Open in IMG/M
3300018807|Ga0193441_1046443All Organisms → cellular organisms → Eukaryota770Open in IMG/M
3300018834|Ga0192877_1096639All Organisms → cellular organisms → Eukaryota794Open in IMG/M
3300018844|Ga0193312_1023951All Organisms → cellular organisms → Eukaryota791Open in IMG/M
3300018849|Ga0193005_1055743All Organisms → cellular organisms → Eukaryota614Open in IMG/M
3300018856|Ga0193120_1126171All Organisms → cellular organisms → Eukaryota590Open in IMG/M
3300018859|Ga0193199_1048253All Organisms → cellular organisms → Eukaryota951Open in IMG/M
3300018861|Ga0193072_1026394All Organisms → cellular organisms → Eukaryota1131Open in IMG/M
3300018887|Ga0193360_1091722All Organisms → cellular organisms → Eukaryota712Open in IMG/M
3300018902|Ga0192862_1100085All Organisms → cellular organisms → Eukaryota719Open in IMG/M
3300018921|Ga0193536_1307901All Organisms → cellular organisms → Eukaryota502Open in IMG/M
3300018935|Ga0193466_1076387All Organisms → cellular organisms → Eukaryota917Open in IMG/M
3300018953|Ga0193567_10130727All Organisms → cellular organisms → Eukaryota824Open in IMG/M
3300018957|Ga0193528_10284332All Organisms → cellular organisms → Eukaryota558Open in IMG/M
3300018961|Ga0193531_10126360All Organisms → cellular organisms → Eukaryota1003Open in IMG/M
3300018964|Ga0193087_10139866All Organisms → cellular organisms → Eukaryota785Open in IMG/M
3300018966|Ga0193293_10097683All Organisms → cellular organisms → Eukaryota568Open in IMG/M
3300018970|Ga0193417_10090208All Organisms → cellular organisms → Eukaryota1028Open in IMG/M
3300018971|Ga0193559_10277162All Organisms → cellular organisms → Eukaryota508Open in IMG/M
3300018978|Ga0193487_10264046All Organisms → cellular organisms → Eukaryota537Open in IMG/M
3300018979|Ga0193540_10108073All Organisms → cellular organisms → Eukaryota773Open in IMG/M
3300018979|Ga0193540_10201871All Organisms → cellular organisms → Eukaryota547Open in IMG/M
3300018980|Ga0192961_10184379All Organisms → cellular organisms → Eukaryota630Open in IMG/M
3300018985|Ga0193136_10208067All Organisms → cellular organisms → Eukaryota584Open in IMG/M
3300018991|Ga0192932_10364766All Organisms → cellular organisms → Eukaryota513Open in IMG/M
3300018993|Ga0193563_10268863All Organisms → cellular organisms → Eukaryota519Open in IMG/M
3300018994|Ga0193280_10122235All Organisms → cellular organisms → Eukaryota1056Open in IMG/M
3300019000|Ga0192953_10158172All Organisms → cellular organisms → Eukaryota571Open in IMG/M
3300019005|Ga0193527_10390003All Organisms → cellular organisms → Eukaryota536Open in IMG/M
3300019006|Ga0193154_10265904All Organisms → cellular organisms → Eukaryota580Open in IMG/M
3300019007|Ga0193196_10348953All Organisms → cellular organisms → Eukaryota629Open in IMG/M
3300019016|Ga0193094_10105296All Organisms → cellular organisms → Eukaryota1044Open in IMG/M
3300019020|Ga0193538_10199502All Organisms → cellular organisms → Eukaryota680Open in IMG/M
3300019023|Ga0193561_10157994All Organisms → cellular organisms → Eukaryota911Open in IMG/M
3300019023|Ga0193561_10210869All Organisms → cellular organisms → Eukaryota752Open in IMG/M
3300019026|Ga0193565_10124592All Organisms → cellular organisms → Eukaryota948Open in IMG/M
3300019030|Ga0192905_10056377All Organisms → cellular organisms → Eukaryota1138Open in IMG/M
3300019038|Ga0193558_10343696All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300019040|Ga0192857_10267698All Organisms → cellular organisms → Eukaryota574Open in IMG/M
3300019041|Ga0193556_10120818All Organisms → cellular organisms → Eukaryota825Open in IMG/M
3300019111|Ga0193541_1039778All Organisms → cellular organisms → Eukaryota813Open in IMG/M
3300019111|Ga0193541_1069931All Organisms → cellular organisms → Eukaryota617Open in IMG/M
3300019112|Ga0193106_1048804All Organisms → cellular organisms → Eukaryota529Open in IMG/M
3300019125|Ga0193104_1052369All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300019131|Ga0193249_1070106All Organisms → cellular organisms → Eukaryota840Open in IMG/M
3300019134|Ga0193515_1085419All Organisms → cellular organisms → Eukaryota538Open in IMG/M
3300019151|Ga0192888_10069714All Organisms → cellular organisms → Eukaryota1196Open in IMG/M
3300021872|Ga0063132_125213All Organisms → cellular organisms → Eukaryota622Open in IMG/M
3300021934|Ga0063139_1042260All Organisms → cellular organisms → Eukaryota710Open in IMG/M
3300031056|Ga0138346_10825680All Organisms → cellular organisms → Eukaryota757Open in IMG/M
3300031121|Ga0138345_10011473All Organisms → cellular organisms → Eukaryota698Open in IMG/M
3300031522|Ga0307388_10798801All Organisms → cellular organisms → Eukaryota633Open in IMG/M
3300031725|Ga0307381_10248927All Organisms → cellular organisms → Eukaryota631Open in IMG/M
3300031734|Ga0307397_10458913All Organisms → cellular organisms → Eukaryota592Open in IMG/M
3300031738|Ga0307384_10157836All Organisms → cellular organisms → Eukaryota978Open in IMG/M
3300031742|Ga0307395_10328327All Organisms → cellular organisms → Eukaryota662Open in IMG/M
3300031750|Ga0307389_10606416All Organisms → cellular organisms → Eukaryota709Open in IMG/M
3300032481|Ga0314668_10222563All Organisms → cellular organisms → Eukaryota966Open in IMG/M
3300032491|Ga0314675_10248286All Organisms → cellular organisms → Eukaryota883Open in IMG/M
3300032615|Ga0314674_10630146All Organisms → cellular organisms → Eukaryota546Open in IMG/M
3300032713|Ga0314690_10641913All Organisms → cellular organisms → Eukaryota517Open in IMG/M
3300032728|Ga0314696_10429796All Organisms → cellular organisms → Eukaryota683Open in IMG/M
3300032745|Ga0314704_10430510All Organisms → cellular organisms → Eukaryota730Open in IMG/M
3300032746|Ga0314701_10426616All Organisms → cellular organisms → Eukaryota599Open in IMG/M
3300032748|Ga0314713_10277933All Organisms → cellular organisms → Eukaryota712Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine78.64%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.77%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300018534Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789412-ERR1719179)EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018612Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782446-ERR1711922)EnvironmentalOpen in IMG/M
3300018626Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789512-ERR1719180)EnvironmentalOpen in IMG/M
3300018639Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782310-ERR1712181)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018664Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789700-ERR1719381)EnvironmentalOpen in IMG/M
3300018677Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789362-ERR1719365)EnvironmentalOpen in IMG/M
3300018685Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782360-ERR1712233)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018700Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789597-ERR1719175)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018707Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018715Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789494-ERR1719339)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018737Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789417-ERR1719385)EnvironmentalOpen in IMG/M
3300018748Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789516-ERR1719249)EnvironmentalOpen in IMG/M
3300018756Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789481-ERR1719268)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018795Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782279-ERR1712192)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018834Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789722-ERR1719319)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018849Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002287 (ERX1789411-ERR1719439)EnvironmentalOpen in IMG/M
3300018856Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782473-ERR1712200)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018887Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789534-ERR1719462)EnvironmentalOpen in IMG/M
3300018902Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789490-ERR1719234)EnvironmentalOpen in IMG/M
3300018921Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789458-ERR1719341)EnvironmentalOpen in IMG/M
3300018935Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789599-ERR1719494)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018971Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003148EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018991Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000884 (ERX1789359-ERR1719369)EnvironmentalOpen in IMG/M
3300018993Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703EnvironmentalOpen in IMG/M
3300018994Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019005Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789730-ERR1719193)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019038Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003141EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019041Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003007EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1046104313300008832MarineMFGYWPWVGLISIIVLFAGVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL*
Ga0103502_1011335323300008998MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSQALPYPQQQAGDFELMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREMAL*
Ga0103502_1019024613300008998MarineMFGYWPWIGLISIVVLFAAVIVIKWGDKVCQARLTVVDHTLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL*
Ga0103706_1000294823300009022Ocean WaterMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQFPPPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL*
Ga0103708_10002393523300009028Ocean WaterMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL*
Ga0138326_1029488723300010985MarineMFGYWPWIGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSMPQQFPQPQAGEIELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTV
Ga0138324_1030800423300010987MarineMFGYWPWIGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL*
Ga0193486_10556023300018534MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193114_102250713300018590MarineKNHHSLTMFAYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193121_104919813300018612MarineVIVIKWGDKVCQARLTVVDHSVAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0192863_102718113300018626MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0192864_103197113300018639MarineMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193445_104529713300018648MarineKTLLSKNHHGQTMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0192906_103862423300018658MarineMFAYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193401_103333613300018664MarineMFGYWPWVGLISIVVLFAAIIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGR
Ga0193404_101746713300018677MarineLNFEQTLILRGPENTEAGKRENCSAMFGYWPWVGLISIVVLFAAMIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0193086_101396423300018685MarineMFGYWPWVGLISIVVLFAAIIVIKWGDKVCQARLTVVDHSLPQHFPQPQADGEFEMMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0192840_101477023300018686MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSQALPYPQQQAGDFELMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREMAL
Ga0193403_103853623300018700MarineMFGYWPWVGLISIVVLFAAMIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRR
Ga0192954_102956223300018704MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPVDHTRQHFQAQPGDFELMEEGNGTMLDMDYQLQEGGSMADYSPHQDGRDSRLTVDTSASGRREIAL
Ga0193539_103452123300018706MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSQALPYPQQQAGDFELMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREMAL
Ga0192876_104223513300018707MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPVDHTRQHFQAQPGDFELMEEGNGTMMDMDYQLQEGGSMADYSPHQDGRDSRLTVDTSASGRREIAL
Ga0192920_105202123300018708MarineMFGYWPWVGLISIIVLFAGVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193209_105277513300018709MarineYQTMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193069_104954113300018711MarineWVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193069_104975013300018711MarineAAVIVIKWGDKVCQARLTVVDHSVAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193537_105529923300018715MarineMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQHYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193036_101702013300018733MarineMFGYWPWVGLISIVVLFAAIIVIKWGDKVCQARLTVVDHSLPQHFPQPQAGEFEMMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193418_103972813300018737MarineMFGYWPWVGLISIVVLFAAIIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0193416_103305923300018748MarineMFGYWPWVGLISIVVLFAAMIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0192931_109759613300018756MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSVAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193212_104336823300018767MarineVLFAAIIVIKWGDKVCQARLTVLDHSHPQHFPQPQAGEFEMMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193212_104958313300018767MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPHPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193478_101860613300018769MarineMFGYWPWIGLISIVVLFAAVIVIKWGDKVCQARLTVVDHTLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0192928_103269023300018793MarineMFGYWPWVGLISIIVLFAGVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0192928_103269213300018793MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0192928_103310913300018793MarineMFAYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0192865_1003410313300018795MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQIQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193117_106021123300018796MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASG
Ga0193441_104644313300018807MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVIDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0192877_109663923300018834MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPIDHTRQHFQAQPGDFELMEEGNGTMMDMDYQLQEGGSMADYSPHQDGRDSRLTVDTSASGRREIAL
Ga0193312_102395123300018844MarineGAAMFGYWPWVGLISIVVLFAAIIVIKWGDKVCQARLTVVDHSLPQHFPQPQADGEFEMMEDGNGTMMDYQLQESGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193005_105574313300018849MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDGNGTMMDYQLQEGGS
Ga0193120_112617113300018856MarineSKNHHSQTMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193199_104825313300018859MarineMFGYWPWVGLISIVVLFAAIIVIKWGDKVCQARLTVLDHSHPQHFPQPQAGEFEMMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193072_102639423300018861MarineVQENRSTMFGYWPWIGLISIVVLFAAVIVIKWGDKVCQARLTVVDHTLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193360_109172213300018887MarineMFGYWPWVGLISIVVLFAAIIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRR
Ga0192862_110008523300018902MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIA
Ga0193536_130790113300018921MarineMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQHYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRR
Ga0193466_107638713300018935MarineLTFEENIGHNRRGDGIDKLLSKNHHGQIMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193567_1013072713300018953MarineMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYPPHGRDSRLTVETSASGRREIAL
Ga0193528_1028433213300018957MarineENHCLAMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSQALPYPQQQAGDFELMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREMAL
Ga0193531_1012636013300018961MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSQAALPYPQQQAGDFELMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREMAL
Ga0193087_1013986613300018964MarineRENCSAMFGYWPWVGLISIVVLFAAMIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0193293_1009768313300018966MarineSIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193417_1009020823300018970MarineLNKTQSLRRPENTEAGKRENCSAMFGYWPWVGLISIVVLFAAMIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0193559_1027716213300018971MarinePWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSVAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193487_1026404623300018978MarineMFGYWPWVGLISIVVLFAAIIVIKWGDKVCQARLTVLDHSHPQHFPQPQAGEFEMMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDS
Ga0193540_1010807323300018979MarineAAVIVIKWGDKVCQARLTVVDHTLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193540_1020187113300018979MarineFAAVIVIKWGDKVCQARLTVVDHSQALPYPQQQAGDFELMEDGNGTMMDYQLQDGGSLGGSVEDYSPHGRDSRLTVETSASGRREMAL
Ga0192961_1018437923300018980MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPVDHTRQHFQAQPGDFELMEEGNGTMMDMDYQLQEGGSMADYSPHQDGRDSRLTADTSASGRREIAL
Ga0193136_1020806723300018985MarineMFGYWPWVGLISIIVLFAGVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPPGRD
Ga0192932_1036476613300018991MarineNHHSQTMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193563_1026886313300018993MarineVIIIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0193280_1012223523300018994MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYPPHGRDSRLTVETSASGRREIAL
Ga0192953_1015817223300019000MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPIDHTRQHFQAQPGDFELMEEGNGTMLDMDYQLQEGGSMADYSPHQDGRDSRLTVDTSASGRREIAL
Ga0193527_1039000313300019005MarineEAGKGENCSAMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193154_1026590423300019006MarineLVGTGYKNLLSKNHHSQTMFGYWPWVGLISIIVLFAAVIVIMGGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193196_1034895313300019007MarineVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193094_1010529613300019016MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTFFTRILYSVLFFIKRTFV
Ga0193538_1019950223300019020MarineMFGYWPWIGLISIVVLFAAVIVIKWGDKVCQARLTVVDHTLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRR
Ga0193561_1015799413300019023MarineMFGYWPWIGLVSIVVLFAAVIVIKWGDKVCQARLAVVDHTLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193561_1021086923300019023MarineMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQHCPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193565_1012459223300019026MarineMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQQYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0192905_1005637723300019030MarineMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQHFPQPQADGEFEMMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193558_1034369613300019038MarineSIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0192857_1026769813300019040MarineTWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSVAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193556_1012081813300019041MarineMFGYWPWVGLISIVVLFAAMIIIKWGDKVCQARLTTVDHSLPQNYPQPQAGEFELMEDGNGTMMNYQLQEGGSLGGSVEDYSPHGRDSRLTVDTSASGRREIAL
Ga0193541_103977813300019111MarineCSAMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQHYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193541_106993113300019111MarineGYWPWIGLISIVVLFAAVVVIKWGDKVCQARLTVVDHSLPQQFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193106_104880413300019112MarineHGVLFAALIVIKWGDKVCQARLTVVDHSVAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0193104_105236913300019125MarineAMFGYWPWVGLISIVVLFAAVIIIKWGDKVCQARLTVVDHSLPQHYPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193249_107010623300019131MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0193515_108541913300019134MarineMGPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0192888_1006971413300019151MarineVVLFAAVIVIKWGDKVCQARLTVVDHTLPQHFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0063132_12521313300021872MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQQFPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0063139_104226023300021934MarineMFGYWPWVGLIATIALLTAVMVIKWGDKLCQARLTTIDHGRQQFQAQPGDFELMEDGNGTMMDYQLQEGGSIADYSPHHDGRDSRLTVDTSASGRREIAL
Ga0138346_1082568013300031056MarineLLSKNHHGSTMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSLAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSRLTVETSASGRREIAL
Ga0138345_1001147313300031121MarineMFGYWPWVGLISIIVLFAAVIVIKWGDKVCQARLTVVDHSVAQQYPPPPQGGDFELMEDGNGTMMDYQLQEGGSLGGSVMEDYSPHGRDSR
Ga0307388_1079880113300031522MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVVDHSLPQPLPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0307381_1024892723300031725MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPVDHTRQHFQAQPGDFELMEEGNGTMLDMDYQLQEGGSMADYSPHQDGRDSRLTVDT
Ga0307397_1045891313300031734MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPVDHTRQHFQAQPGDFELMEEGNGTMLDMDYQLQEGGSMADYSPHQDGRDSRLTV
Ga0307384_1015783613300031738MarineMFGYWPWVGLISIVVLFAAVIVIKWGDKVCQARLTVIDHSLPQPLPQPQAGEFELMEDGNGTMMDYQLQEGGSLGGSVEDYSPHGRDSRLTVETSASGRREIAL
Ga0307395_1032832713300031742MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPIDHTRQHFQAQPGDFELMEEGNGTVMDMDYQLQEGGSMADYSPHQDGRDSRLTVDTSASGRREIAL
Ga0307389_1060641623300031750MarineMFGYWPWVGLIAAIALLAAVMVIKWGDKICQARLTPVDHTRQHFQAQPGDFELMEEGNGTMLDMDYQLQEGGSMADYSPHQDGRSVGW
Ga0314668_1022256313300032481SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDRLCQARLTPIDHSRLDQFGAQPEDFDMEMEDGNGTMVDFTLQEGSLHDSHGRDSRLTMDTSASGRREMAL
Ga0314675_1024828623300032491SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDKLCQARLTPIDHSRLDQFGAQPEDFDMEMEDGNGTMVDFTLQEGSLHDSHGRDSRLTIDTSASGRREMAL
Ga0314674_1063014623300032615SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDKLCQARLTPIDHSRLDQFGAQPEDFDMEMEDGNGTMVDFTLQEGSLHDSHGRDSRLTMDTSASGRREMA
Ga0314690_1064191313300032713SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDRLCQARLTPIDHTRLDQFGAQPEDFDMEMDDGNGTMVDFTLQEGSLHDSHGRDSRLTVDTS
Ga0314696_1042979613300032728SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDKLCQARLTPIDHSRLDQFGAQPEDFDMEMEDGNGTMVDFTLQEGSLHDSHGRDSRLTMDTSASGRREMAL
Ga0314704_1043051013300032745SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDRLCQARLTPIDHSRLDQFGAQPEDFDMEMEDGNGTMVDFTLQEGSLHDSHGRDSRLTMDTSASGRRE
Ga0314701_1042661613300032746SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDRLCQARLTPIDHTRLDQFGAQPEDFDMEMDDGNGTMVDFTLQEGSLHDSHGRDSRLTVDTSASGRREMAL
Ga0314713_1027793323300032748SeawaterMFGYWPWIGLISIIVLLTAVMVIKWGDKLCQARLTPVDHTRLDQFGAQPEDFDMEMDDGNGTMVDFTLQEGSLHDSHGRDSRLTVDT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.