


| Basic Information | |
|---|---|
| Family ID | F098150 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPA |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 86.54 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.269 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.769 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01594 | AI-2E_transport | 4.81 |
| PF03795 | YCII | 2.88 |
| PF08281 | Sigma70_r4_2 | 2.88 |
| PF01042 | Ribonuc_L-PSP | 2.88 |
| PF00313 | CSD | 2.88 |
| PF00912 | Transgly | 1.92 |
| PF13376 | OmdA | 1.92 |
| PF13602 | ADH_zinc_N_2 | 1.92 |
| PF03572 | Peptidase_S41 | 1.92 |
| PF12796 | Ank_2 | 1.92 |
| PF02371 | Transposase_20 | 1.92 |
| PF03992 | ABM | 1.92 |
| PF01022 | HTH_5 | 1.92 |
| PF08240 | ADH_N | 1.92 |
| PF00106 | adh_short | 0.96 |
| PF00294 | PfkB | 0.96 |
| PF00891 | Methyltransf_2 | 0.96 |
| PF01292 | Ni_hydr_CYTB | 0.96 |
| PF12680 | SnoaL_2 | 0.96 |
| PF00107 | ADH_zinc_N | 0.96 |
| PF05977 | MFS_3 | 0.96 |
| PF00903 | Glyoxalase | 0.96 |
| PF04542 | Sigma70_r2 | 0.96 |
| PF11138 | DUF2911 | 0.96 |
| PF13620 | CarboxypepD_reg | 0.96 |
| PF03544 | TonB_C | 0.96 |
| PF06445 | GyrI-like | 0.96 |
| PF00128 | Alpha-amylase | 0.96 |
| PF07676 | PD40 | 0.96 |
| PF04453 | LptD | 0.96 |
| PF12840 | HTH_20 | 0.96 |
| PF12704 | MacB_PCD | 0.96 |
| PF06197 | DUF998 | 0.96 |
| PF02687 | FtsX | 0.96 |
| PF07470 | Glyco_hydro_88 | 0.96 |
| PF01872 | RibD_C | 0.96 |
| PF13858 | DUF4199 | 0.96 |
| PF07366 | SnoaL | 0.96 |
| PF03734 | YkuD | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 4.81 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.88 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.88 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 1.92 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.92 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.96 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.96 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.96 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1452 | LPS assembly outer membrane protein LptD (organic solvent tolerance protein OstA) | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.96 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.96 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.96 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.96 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.96 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.96 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.96 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.96 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.96 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.27 % |
| Unclassified | root | N/A | 31.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10018746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1901 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10089102 | Not Available | 767 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10096089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300002914|JGI25617J43924_10016814 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
| 3300004156|Ga0062589_102372532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300004633|Ga0066395_10713770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300005437|Ga0070710_10438781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 883 | Open in IMG/M |
| 3300005458|Ga0070681_11088261 | Not Available | 720 | Open in IMG/M |
| 3300005556|Ga0066707_10768699 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005559|Ga0066700_10428392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 931 | Open in IMG/M |
| 3300005598|Ga0066706_10034661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3263 | Open in IMG/M |
| 3300005764|Ga0066903_100355905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2371 | Open in IMG/M |
| 3300005764|Ga0066903_101407851 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300005891|Ga0075283_1064293 | Not Available | 648 | Open in IMG/M |
| 3300006163|Ga0070715_10076718 | Not Available | 1507 | Open in IMG/M |
| 3300006176|Ga0070765_101794321 | Not Available | 575 | Open in IMG/M |
| 3300006797|Ga0066659_11691956 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Uhrbacteria → Candidatus Uhrbacteria bacterium RIFCSPHIGHO2_01_FULL_63_20 | 533 | Open in IMG/M |
| 3300006914|Ga0075436_101277289 | Not Available | 555 | Open in IMG/M |
| 3300009012|Ga0066710_100296883 | All Organisms → cellular organisms → Bacteria | 2364 | Open in IMG/M |
| 3300010043|Ga0126380_11170169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 661 | Open in IMG/M |
| 3300010048|Ga0126373_13228494 | Not Available | 507 | Open in IMG/M |
| 3300010049|Ga0123356_12083000 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010358|Ga0126370_10533774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300010358|Ga0126370_11931864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010358|Ga0126370_12300085 | Not Available | 533 | Open in IMG/M |
| 3300010358|Ga0126370_12501763 | Not Available | 514 | Open in IMG/M |
| 3300010360|Ga0126372_10451580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Chondromyces → Chondromyces apiculatus | 1191 | Open in IMG/M |
| 3300010360|Ga0126372_10791252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300010360|Ga0126372_11971897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 630 | Open in IMG/M |
| 3300010361|Ga0126378_11351116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300010366|Ga0126379_11361696 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300010376|Ga0126381_100779854 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300012206|Ga0137380_10903498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 758 | Open in IMG/M |
| 3300012361|Ga0137360_10050563 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300012683|Ga0137398_10081178 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300012971|Ga0126369_10547099 | Not Available | 1222 | Open in IMG/M |
| 3300012971|Ga0126369_11994865 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 668 | Open in IMG/M |
| 3300013100|Ga0157373_10934153 | Not Available | 645 | Open in IMG/M |
| 3300013105|Ga0157369_10164208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2342 | Open in IMG/M |
| 3300016270|Ga0182036_10873037 | Not Available | 736 | Open in IMG/M |
| 3300016341|Ga0182035_11772191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 559 | Open in IMG/M |
| 3300016357|Ga0182032_11277126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300016357|Ga0182032_11772392 | Not Available | 539 | Open in IMG/M |
| 3300016387|Ga0182040_10341732 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300016404|Ga0182037_10345931 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300016422|Ga0182039_10995068 | Not Available | 752 | Open in IMG/M |
| 3300016445|Ga0182038_10121224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1943 | Open in IMG/M |
| 3300016445|Ga0182038_10143271 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300016445|Ga0182038_11652554 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300017961|Ga0187778_11170105 | Not Available | 538 | Open in IMG/M |
| 3300017966|Ga0187776_10989612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300017970|Ga0187783_10079532 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
| 3300017972|Ga0187781_11394570 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300017974|Ga0187777_10023652 | All Organisms → cellular organisms → Bacteria | 3912 | Open in IMG/M |
| 3300018062|Ga0187784_10061638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3038 | Open in IMG/M |
| 3300018062|Ga0187784_11368955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300018086|Ga0187769_10400323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1032 | Open in IMG/M |
| 3300018086|Ga0187769_10595054 | Not Available | 836 | Open in IMG/M |
| 3300018088|Ga0187771_11538171 | Not Available | 565 | Open in IMG/M |
| 3300018089|Ga0187774_10365535 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300018090|Ga0187770_11751141 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300021168|Ga0210406_10797773 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300021402|Ga0210385_10110626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1927 | Open in IMG/M |
| 3300021560|Ga0126371_10117142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2681 | Open in IMG/M |
| 3300021560|Ga0126371_10553473 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300021560|Ga0126371_12639081 | Not Available | 609 | Open in IMG/M |
| 3300025907|Ga0207645_10640054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300025911|Ga0207654_11022587 | Not Available | 601 | Open in IMG/M |
| 3300025912|Ga0207707_10784126 | Not Available | 795 | Open in IMG/M |
| 3300025945|Ga0207679_11623039 | Not Available | 592 | Open in IMG/M |
| 3300026343|Ga0209159_1248734 | Not Available | 541 | Open in IMG/M |
| 3300028906|Ga0308309_11407496 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300030618|Ga0311354_10484671 | Not Available | 1226 | Open in IMG/M |
| 3300031545|Ga0318541_10812770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300031572|Ga0318515_10127923 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300031716|Ga0310813_12318378 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031719|Ga0306917_10551285 | Not Available | 906 | Open in IMG/M |
| 3300031719|Ga0306917_11242717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300031747|Ga0318502_10462352 | Not Available | 758 | Open in IMG/M |
| 3300031777|Ga0318543_10149187 | Not Available | 1027 | Open in IMG/M |
| 3300031879|Ga0306919_10391921 | Not Available | 1064 | Open in IMG/M |
| 3300031890|Ga0306925_10333242 | Not Available | 1630 | Open in IMG/M |
| 3300031897|Ga0318520_10954234 | Not Available | 541 | Open in IMG/M |
| 3300031910|Ga0306923_10093208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3391 | Open in IMG/M |
| 3300031910|Ga0306923_10353812 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300031912|Ga0306921_10193303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2385 | Open in IMG/M |
| 3300031912|Ga0306921_12242272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300031941|Ga0310912_10706304 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031946|Ga0310910_10141374 | Not Available | 1833 | Open in IMG/M |
| 3300031947|Ga0310909_10970303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300031954|Ga0306926_11661816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300031954|Ga0306926_12986341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300032025|Ga0318507_10336840 | Not Available | 657 | Open in IMG/M |
| 3300032174|Ga0307470_10242681 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300032261|Ga0306920_101020483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300032261|Ga0306920_104020378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300032783|Ga0335079_11955349 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 566 | Open in IMG/M |
| 3300032805|Ga0335078_10226804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2570 | Open in IMG/M |
| 3300032805|Ga0335078_12041062 | Not Available | 612 | Open in IMG/M |
| 3300032805|Ga0335078_12411344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300032955|Ga0335076_11464192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 569 | Open in IMG/M |
| 3300033158|Ga0335077_11134857 | Not Available | 770 | Open in IMG/M |
| 3300033158|Ga0335077_11969329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300033289|Ga0310914_11225430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 11.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100187463 | 3300000597 | Forest Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPA |
| AF_2010_repII_A1DRAFT_100891022 | 3300000597 | Forest Soil | MIFQRRQLLQIASYAFGSTFVLPQIKLATAAQNPAPPTS |
| AF_2010_repII_A1DRAFT_100960891 | 3300000597 | Forest Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPAKA |
| JGI25617J43924_100168145 | 3300002914 | Grasslands Soil | MSFQRRQLLQIFSYAFGASFILPKNELAMAAQNPTQPASPV |
| Ga0062589_1023725321 | 3300004156 | Soil | MSFQRRRLIQILSYAVGSSFILPQNELAMAAQNSAQPANPAPPAKTAAK |
| Ga0066395_107137702 | 3300004633 | Tropical Forest Soil | MSLQRRQLLRVLTGAFGSGFILPHSELAMAAQTPAQPASPAPA |
| Ga0070710_104387811 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFQRRQLLQILSYAFGASFILPRNGLAMAAQEPAQTASPAPPAKAAAKH |
| Ga0070681_110882611 | 3300005458 | Corn Rhizosphere | MSFQRRQFLQALSYAFGSSFILSRNGFAIATQKAAQPASP |
| Ga0066707_107686992 | 3300005556 | Soil | MSFQRRQLLQILSYVLGSSFILRGNEFAMAAQNSAQ |
| Ga0066700_104283923 | 3300005559 | Soil | MSFQRRQLLQILSYVLGSSFILRRNEFAMSAQNSAQLASPAPPAKEAAKH |
| Ga0066706_100346616 | 3300005598 | Soil | MSFQRRQLLQISSYAFGASFILPKNELAMAPQNPTQPASPVPPAKAD |
| Ga0066903_1003559051 | 3300005764 | Tropical Forest Soil | MSFQRRQLLQILSYAFGSSFILSRNGLAMAAQNPAQPA |
| Ga0066903_1014078513 | 3300005764 | Tropical Forest Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAKAAAKHE |
| Ga0075283_10642931 | 3300005891 | Rice Paddy Soil | MSFHRRQFLHILSYAFGVGFILPRNELAVAGQNSAQPASPAPPAQAVA |
| Ga0070715_100767182 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFQRRQLLQILSYAFGSSFILPRNGLAIAAREPAQTASPAPPAKAAAKHE |
| Ga0070765_1017943212 | 3300006176 | Soil | MSLPRRQLLQIVSSAFGFSFILPGNEFAMAAQSAAQLASPA |
| Ga0066659_116919561 | 3300006797 | Soil | MSFRRRQLLQILSYAFGSSFILPRNEFVMAAQNPAQPASPAPPA |
| Ga0075436_1012772891 | 3300006914 | Populus Rhizosphere | MSFQRRKLLQILSYAFGSGFILPRNGLAMAAQDPAQPAS |
| Ga0066710_1002968831 | 3300009012 | Grasslands Soil | MSFQRRQLLQISSYAFGASFILPKNELAMAAQNPTQPASPVP |
| Ga0126380_111701692 | 3300010043 | Tropical Forest Soil | MSFQRRKLLQILSYAFGAGVILPRNGLAMAAQNPAQ |
| Ga0126373_132284941 | 3300010048 | Tropical Forest Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGS |
| Ga0123356_120830001 | 3300010049 | Termite Gut | MSLQRRRVLQVLSYALGSGFVLAKNGFAMTAQSAAQAASPQHGA |
| Ga0126370_105337743 | 3300010358 | Tropical Forest Soil | MSLQRRQLLQVLSYTFGASFILPQSELATAAQNPAQPGGPAPPAKA |
| Ga0126370_119318641 | 3300010358 | Tropical Forest Soil | MSLQRRQLLRVLTGAFGSGFILPHSEFAMAAQTPAQPASPAPASKAAVKQ |
| Ga0126370_123000851 | 3300010358 | Tropical Forest Soil | MSFERRQLLQVLSYAFGSSFILPRNEFAVAAQNPAQPASPAPPAKAAAKHESGG |
| Ga0126370_125017631 | 3300010358 | Tropical Forest Soil | MNAPRRAVLQILSYAFGSGFLLPQKEFAEAVQKPAEPASPAPPA |
| Ga0126372_104515803 | 3300010360 | Tropical Forest Soil | MSFQRRRFIQVLSLGFGASFILPQSGLAVAAQNPAEPVNPATLAKAAVR |
| Ga0126372_107912522 | 3300010360 | Tropical Forest Soil | MSFQRRQLLQLLPYAFGSNFILPQIELAMAAQNPAQPASPAP |
| Ga0126372_119718972 | 3300010360 | Tropical Forest Soil | MSFQRRQLLQTLSFAFGSSFILPRSKFAMAQNPAPPA |
| Ga0126378_113511161 | 3300010361 | Tropical Forest Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAKAA |
| Ga0126379_113616962 | 3300010366 | Tropical Forest Soil | MSFQRRQLLQILSYAFGASFIPPQNELVIAAQNPT |
| Ga0126381_1007798543 | 3300010376 | Tropical Forest Soil | MSLQRRQVLQVLSYAFGSSFILPQNEFAMAAQNPAQPANPAPPAKAAAK |
| Ga0137380_109034981 | 3300012206 | Vadose Zone Soil | MSFQRRQLLQILSYAFGSSFILRRNEFAMAAQNSAQPASPVPPAK |
| Ga0137360_100505636 | 3300012361 | Vadose Zone Soil | MSFQRRQLLQIFSYAFGASFILPKNELAMAAQNPTQPASPVPPAKADAKHES |
| Ga0137398_100811781 | 3300012683 | Vadose Zone Soil | MSFQRRQLLQILSYVLGSSFILRRNEFAMAAQNSTLPASPAPPAKVAAKHE |
| Ga0126369_105470992 | 3300012971 | Tropical Forest Soil | MSLQRRQLLRVLTGAFGSGFILPHSELAMAAQTPA |
| Ga0126369_119948652 | 3300012971 | Tropical Forest Soil | MSFQRRRLLQLLSYTFGASFILPQSELAMVAQNSTQPASPAPPAKATAK |
| Ga0157373_109341532 | 3300013100 | Corn Rhizosphere | MGFQRRQLLQILPYAFGSSLILPQIELDAAAQNPVQPVGAASPA |
| Ga0157369_101642083 | 3300013105 | Corn Rhizosphere | MSFQRRKLLQTLSYAFGASFILPRNGLATAAQNPAQPANAAPPAKEGAKHESGE |
| Ga0182036_108730372 | 3300016270 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPAEAAA |
| Ga0182035_117721911 | 3300016341 | Soil | MSFERRQILQILSYAFGSSFILPRNEFAMAAQNPAQP |
| Ga0182032_112771262 | 3300016357 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPAKAAAKHE |
| Ga0182032_117723921 | 3300016357 | Soil | MSFERRRILQILSYAFGSSFILPGNEFAVAGQNPAQ |
| Ga0182040_103417323 | 3300016387 | Soil | MSFQRRRFLQILSYAFGSSFILPQNELATSAQVPAQP |
| Ga0182037_103459311 | 3300016404 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPAKAA |
| Ga0182039_109950681 | 3300016422 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAKAAAKHES |
| Ga0182038_101212242 | 3300016445 | Soil | MSLQRRQLLQILSYAFGSLSRNEFAMVAQNPAQPASPAPPAKAALHINREERKWKK |
| Ga0182038_101432715 | 3300016445 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPAS |
| Ga0182038_116525541 | 3300016445 | Soil | MSFQRRQLLQILSYAFGSSFILPRNVAMAAQNPARSPAPPI |
| Ga0187778_111701052 | 3300017961 | Tropical Peatland | MSFPRRQLFRILSYAFGSSVILPRIEFAVAAQNSAQPESPTSLAQAAK |
| Ga0187776_109896122 | 3300017966 | Tropical Peatland | MTFQRRQLLQILSYAFGSSFILPQIELAVAAQNPEKPASPAPPA |
| Ga0187783_100795322 | 3300017970 | Tropical Peatland | MTLQRRQLLQILSYAFGSSFILPQNALAMTAQNPAQPVSLAPPAKLLT |
| Ga0187781_113945701 | 3300017972 | Tropical Peatland | MSVQRRQLLQMLSYAFGASFILPQIDVAIAAQNPEQPASPAPP |
| Ga0187777_100236521 | 3300017974 | Tropical Peatland | MSFQRRQLLQILSYAVGASFLLPKNELTMAAQNSAQPASPAPPAKAAAKH |
| Ga0187784_100616385 | 3300018062 | Tropical Peatland | MSFQRRQLLQILSYVFGAGFILPQNELAMTAQNPAQP |
| Ga0187784_113689551 | 3300018062 | Tropical Peatland | MSFQRRQLLQILSYTFGASFILPQNELAMAAQNPAQPASAAPT |
| Ga0187769_104003231 | 3300018086 | Tropical Peatland | MSFQRRQLLQILSYACASSFILPRKELAMAAQNSAQPASPA |
| Ga0187769_105950542 | 3300018086 | Tropical Peatland | MSFERRQVLQILPYAFGSSIILPQIELAGAAQNPAQPA |
| Ga0187771_115381711 | 3300018088 | Tropical Peatland | MSFQRRQLLQILSYAFGSSFILPQNEAAMAAQNPASPASPAPPAKAAAEHESGG |
| Ga0187774_103655352 | 3300018089 | Tropical Peatland | MSIQRRQLLQILSYAFGSSFILPQNEFAMAAQNLA |
| Ga0187770_117511412 | 3300018090 | Tropical Peatland | MSFQRRQLLQILSYTFGASVVLSRNELAMAAQNSAQPASPAPPAKA |
| Ga0210406_107977732 | 3300021168 | Soil | MRFQRRQLLQILSYAFGSSFILSRNEFAIAVHNPLQSAPTAKAAAEHEL |
| Ga0210385_101106262 | 3300021402 | Soil | MSLPRRQLLQIVSSAFGFSFILPGNEFAMAAQSAAQLA |
| Ga0126371_101171421 | 3300021560 | Tropical Forest Soil | MSLQRRQLLQVLSYAFGSSFILPQNEFAMAAQNPAQPANP |
| Ga0126371_105534733 | 3300021560 | Tropical Forest Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAKA |
| Ga0126371_126390812 | 3300021560 | Tropical Forest Soil | MSFQRRQLLKILSYTFGAGFILPRNELANAAQNAAQPPSPVPPVKSATKDESKG |
| Ga0207645_106400542 | 3300025907 | Miscanthus Rhizosphere | MSFQRRRLIQILSYAVGSSFILPQNELAMAAQNSAQPANPAPPAK |
| Ga0207654_110225873 | 3300025911 | Corn Rhizosphere | MSFQRRQLLQILPYAFGSSFILPQNKLAVAAQNPPQSAIPAP |
| Ga0207707_107841262 | 3300025912 | Corn Rhizosphere | MSFQRRQFLQALSYAFGSSFILSRNGFAIATQKAAQPASPAPPAQAAVKQE |
| Ga0207679_116230391 | 3300025945 | Corn Rhizosphere | MGFQRRQLLQILPYAFGSSLILPQIELDAAAQNPVQPVGAASPAETPA |
| Ga0209159_12487342 | 3300026343 | Soil | MSFQRRQLLQILSYVFGSSFTLRRNEFAMAAQNSAQPASPAPPAKAAAKHESG |
| Ga0308309_114074961 | 3300028906 | Soil | MSLPRRQLLQIVSSAFGFSFILPGNEFAMAAQSAAQLASPAA |
| Ga0311354_104846712 | 3300030618 | Palsa | MSFERRQLLQTLSYAFGFSFILPINELTMAAQNPGQAASPAPPAKAAAGHES |
| Ga0318541_108127702 | 3300031545 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPA |
| Ga0318515_101279231 | 3300031572 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPG |
| Ga0310813_123183781 | 3300031716 | Soil | MSFPRREFLQVLSYALGSTVILPRNEFAMAAQSPAQ |
| Ga0306917_105512851 | 3300031719 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASP |
| Ga0306917_112427171 | 3300031719 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAKAAAKHESGG |
| Ga0318502_104623521 | 3300031747 | Soil | MSFERRQLLQLLSYAFGSSFILPRNEFAMAAQNPA |
| Ga0318543_101491871 | 3300031777 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAKAAAKHESG |
| Ga0306919_103919211 | 3300031879 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFPMAAQDPAQPASPAPPAKVAA |
| Ga0306925_103332421 | 3300031890 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPAEAAAKHESRGT |
| Ga0318520_109542341 | 3300031897 | Soil | MSVQRRQLLQIFSYAFGSSVILPGDEFAMAAQNPAQPGSPAQPAKAAAKYE |
| Ga0306923_100932081 | 3300031910 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPA |
| Ga0306923_103538121 | 3300031910 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAKAAAKH |
| Ga0306921_101933031 | 3300031912 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPAKAAA |
| Ga0306921_122422722 | 3300031912 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFPMAAQDPAQPA |
| Ga0310912_107063042 | 3300031941 | Soil | MSFQRRQLLQILSYAFGSSFILPRNVAMAAQNPAR |
| Ga0310910_101413743 | 3300031946 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPASPAPPAEAAAKHESR |
| Ga0310909_109703033 | 3300031947 | Soil | MSVPRRQLLQIFSYAFGSSVIPLRNQFAVVAQNPAQPASPATR |
| Ga0306926_116618161 | 3300031954 | Soil | MSLERRQLLQILSYAIGSSFILHRNELAMAAQNPAQLASPAPPAKAAAKHESG |
| Ga0306926_129863411 | 3300031954 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQP |
| Ga0318507_103368402 | 3300032025 | Soil | MSFQRRQVLRILSYTFGYSFTLPQNELTMAAQNPAQPPSSAPPAA |
| Ga0307470_102426811 | 3300032174 | Hardwood Forest Soil | MSFQRRQFLQILSYAFGFSFILPQNELAMAAQNPAQPASPAP |
| Ga0306920_1010204831 | 3300032261 | Soil | MSRQLLQILSYAFGASFILPRNEFAMAAQNPAQPASPAPPAKAAA |
| Ga0306920_1040203781 | 3300032261 | Soil | MSFERRQLLQILSYAFGSSFILPRNEFAMAAQNPAQPGSPAPPAK |
| Ga0335079_119553491 | 3300032783 | Soil | MGFRRRQLLQVLSYTFGASLILPRSESAMAAQNAAEPASPAPPAKVAAKH |
| Ga0335078_102268043 | 3300032805 | Soil | MSFQRRQLLQILSYAVGASFILPQNELVMAAQNPAQPANPAPPAKAAPQNTNREERKWKK |
| Ga0335078_120410621 | 3300032805 | Soil | MSLQRRRLLQILSYGVGSSFILPRNGFAMTAQNPAQPANPAPPAKAAAK |
| Ga0335078_124113441 | 3300032805 | Soil | MRFQRRQLLQMLTGAVGAGFILPKNEFAIAAQNSAQPASPAPAGKASAKNQ |
| Ga0335076_114641921 | 3300032955 | Soil | LSFERRQLLQALSYAFGSSLMPRGAFVLAAQNPAQSVSPASPAQAAVKNQSEGKQM |
| Ga0335077_111348571 | 3300033158 | Soil | MSLQRRQLLQVLSYAFGATFILPQNDLAMAAQNAAQPASLA |
| Ga0335077_119693292 | 3300033158 | Soil | MSFQRRQLLQILSYALSSFILPKNGLAMAAQSPAQPASPALAAKA |
| Ga0310914_112254301 | 3300033289 | Soil | MSIQRRQLLRILSYAFGSIFLLFRNKFIVAAQNSG |
| ⦗Top⦘ |