


| Basic Information | |
|---|---|
| Family ID | F098127 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MGTLDVPEILIGLGLVAGLFWALYNWTHPHENAPK |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.95 % |
| % of genes near scaffold ends (potentially truncated) | 3.85 % |
| % of genes from short scaffolds (< 2000 bps) | 42.31 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.654 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (16.346 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.808 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.92% β-sheet: 0.00% Coil/Unstructured: 65.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 8.65 |
| PF00809 | Pterin_bind | 8.65 |
| PF00873 | ACR_tran | 7.69 |
| PF00076 | RRM_1 | 7.69 |
| PF00196 | GerE | 6.73 |
| PF01596 | Methyltransf_3 | 4.81 |
| PF02702 | KdpD | 3.85 |
| PF13709 | DUF4159 | 2.88 |
| PF00069 | Pkinase | 2.88 |
| PF13676 | TIR_2 | 2.88 |
| PF01103 | Omp85 | 1.92 |
| PF13188 | PAS_8 | 1.92 |
| PF04014 | MazE_antitoxin | 1.92 |
| PF13519 | VWA_2 | 0.96 |
| PF01081 | Aldolase | 0.96 |
| PF01564 | Spermine_synth | 0.96 |
| PF03551 | PadR | 0.96 |
| PF04966 | OprB | 0.96 |
| PF02633 | Creatininase | 0.96 |
| PF03454 | MoeA_C | 0.96 |
| PF11737 | DUF3300 | 0.96 |
| PF03737 | RraA-like | 0.96 |
| PF13464 | DUF4115 | 0.96 |
| PF01566 | Nramp | 0.96 |
| PF10128 | OpcA_G6PD_assem | 0.96 |
| PF01850 | PIN | 0.96 |
| PF13517 | FG-GAP_3 | 0.96 |
| PF11453 | DUF2950 | 0.96 |
| PF03484 | B5 | 0.96 |
| PF01409 | tRNA-synt_2d | 0.96 |
| PF13560 | HTH_31 | 0.96 |
| PF03147 | FDX-ACB | 0.96 |
| PF02321 | OEP | 0.96 |
| PF02517 | Rce1-like | 0.96 |
| PF12704 | MacB_PCD | 0.96 |
| PF00291 | PALP | 0.96 |
| PF08530 | PepX_C | 0.96 |
| PF14259 | Obsolete Pfam Family | 0.96 |
| PF00326 | Peptidase_S9 | 0.96 |
| PF02653 | BPD_transp_2 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.54 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 4.81 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 4.81 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 4.81 |
| COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 3.85 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 1.92 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.96 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.96 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.96 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.96 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.96 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.96 |
| COG2024 | O-phosphoseryl-tRNA(Cys) synthetase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.96 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.65 % |
| Unclassified | root | N/A | 16.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908028|beta3_all_NODE_87130_len_732_cov_6_960382 | Not Available | 782 | Open in IMG/M |
| 2140918024|NODE_491286_length_3551_cov_10.244157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3601 | Open in IMG/M |
| 3300001356|JGI12269J14319_10032508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3432 | Open in IMG/M |
| 3300005534|Ga0070735_10010538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7113 | Open in IMG/M |
| 3300005537|Ga0070730_10010580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7568 | Open in IMG/M |
| 3300005541|Ga0070733_10012003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5453 | Open in IMG/M |
| 3300005921|Ga0070766_10173389 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300006052|Ga0075029_100025182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3351 | Open in IMG/M |
| 3300006052|Ga0075029_100605295 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 732 | Open in IMG/M |
| 3300006052|Ga0075029_100607036 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 731 | Open in IMG/M |
| 3300006059|Ga0075017_100233998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1339 | Open in IMG/M |
| 3300006162|Ga0075030_100375209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1134 | Open in IMG/M |
| 3300006163|Ga0070715_10332415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 824 | Open in IMG/M |
| 3300006797|Ga0066659_11058245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 678 | Open in IMG/M |
| 3300009548|Ga0116107_1046859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
| 3300009628|Ga0116125_1136646 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010376|Ga0126381_100059497 | All Organisms → cellular organisms → Bacteria | 4714 | Open in IMG/M |
| 3300010379|Ga0136449_100049669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9463 | Open in IMG/M |
| 3300010379|Ga0136449_100430215 | Not Available | 2326 | Open in IMG/M |
| 3300010379|Ga0136449_103616166 | Not Available | 586 | Open in IMG/M |
| 3300010937|Ga0137776_1796396 | Not Available | 607 | Open in IMG/M |
| 3300011270|Ga0137391_10019341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5603 | Open in IMG/M |
| 3300012210|Ga0137378_10183463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1946 | Open in IMG/M |
| 3300014155|Ga0181524_10034283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3448 | Open in IMG/M |
| 3300014158|Ga0181521_10012606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7914 | Open in IMG/M |
| 3300014160|Ga0181517_10124304 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300014161|Ga0181529_10000290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 74035 | Open in IMG/M |
| 3300014200|Ga0181526_10038490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3073 | Open in IMG/M |
| 3300014494|Ga0182017_10043327 | All Organisms → cellular organisms → Bacteria | 3020 | Open in IMG/M |
| 3300014494|Ga0182017_10893014 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300014496|Ga0182011_10020275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4833 | Open in IMG/M |
| 3300014496|Ga0182011_10647750 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300014502|Ga0182021_10078336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3837 | Open in IMG/M |
| 3300014502|Ga0182021_10632013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300014839|Ga0182027_10013029 | All Organisms → cellular organisms → Bacteria | 11634 | Open in IMG/M |
| 3300014839|Ga0182027_10175700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2503 | Open in IMG/M |
| 3300014839|Ga0182027_10211174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2244 | Open in IMG/M |
| 3300014839|Ga0182027_10574790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300014839|Ga0182027_10578999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300014839|Ga0182027_10707736 | Not Available | 1066 | Open in IMG/M |
| 3300016750|Ga0181505_10440575 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300017929|Ga0187849_1006958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8427 | Open in IMG/M |
| 3300017934|Ga0187803_10004210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5686 | Open in IMG/M |
| 3300017941|Ga0187850_10017538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4232 | Open in IMG/M |
| 3300017966|Ga0187776_11027176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 607 | Open in IMG/M |
| 3300017973|Ga0187780_10718402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300017988|Ga0181520_10088706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2699 | Open in IMG/M |
| 3300017988|Ga0181520_10276663 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300017995|Ga0187816_10587079 | Not Available | 501 | Open in IMG/M |
| 3300017999|Ga0187767_10075766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300018023|Ga0187889_10007229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8138 | Open in IMG/M |
| 3300019273|Ga0187794_1059559 | Not Available | 513 | Open in IMG/M |
| 3300020581|Ga0210399_10026913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4581 | Open in IMG/M |
| 3300021478|Ga0210402_10000061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 111150 | Open in IMG/M |
| 3300021559|Ga0210409_11602971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300021858|Ga0213852_1191638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1910 | Open in IMG/M |
| 3300021861|Ga0213853_10422884 | Not Available | 764 | Open in IMG/M |
| 3300021861|Ga0213853_10946455 | Not Available | 504 | Open in IMG/M |
| 3300022524|Ga0224534_1001396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 12795 | Open in IMG/M |
| 3300023090|Ga0224558_1014680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4383 | Open in IMG/M |
| 3300025888|Ga0209540_10066963 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300026319|Ga0209647_1211348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 664 | Open in IMG/M |
| 3300027641|Ga0208827_1074023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1071 | Open in IMG/M |
| 3300027825|Ga0209039_10001381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22739 | Open in IMG/M |
| 3300027857|Ga0209166_10026263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3569 | Open in IMG/M |
| 3300027867|Ga0209167_10011541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4187 | Open in IMG/M |
| 3300027889|Ga0209380_10255184 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300027898|Ga0209067_10000269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 35940 | Open in IMG/M |
| 3300027911|Ga0209698_10378527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300027911|Ga0209698_10844452 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 690 | Open in IMG/M |
| 3300027986|Ga0209168_10038960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2587 | Open in IMG/M |
| 3300031344|Ga0265316_10010869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8266 | Open in IMG/M |
| 3300031344|Ga0265316_10040265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3747 | Open in IMG/M |
| 3300031344|Ga0265316_10322283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300031716|Ga0310813_10080575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2483 | Open in IMG/M |
| 3300032160|Ga0311301_10020115 | All Organisms → cellular organisms → Bacteria | 18925 | Open in IMG/M |
| 3300032160|Ga0311301_10303759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2553 | Open in IMG/M |
| 3300032160|Ga0311301_10598949 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300032160|Ga0311301_12632561 | Not Available | 557 | Open in IMG/M |
| 3300032770|Ga0335085_10018203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 10104 | Open in IMG/M |
| 3300032770|Ga0335085_10100971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3728 | Open in IMG/M |
| 3300032770|Ga0335085_10159581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2816 | Open in IMG/M |
| 3300032770|Ga0335085_11566857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300032770|Ga0335085_12028653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300032783|Ga0335079_10006726 | All Organisms → cellular organisms → Bacteria | 13152 | Open in IMG/M |
| 3300032783|Ga0335079_10008081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 11973 | Open in IMG/M |
| 3300032783|Ga0335079_10041338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5293 | Open in IMG/M |
| 3300032783|Ga0335079_10044925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5067 | Open in IMG/M |
| 3300032783|Ga0335079_10147148 | All Organisms → cellular organisms → Bacteria | 2645 | Open in IMG/M |
| 3300032783|Ga0335079_10437536 | Not Available | 1404 | Open in IMG/M |
| 3300032805|Ga0335078_10915072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1051 | Open in IMG/M |
| 3300032892|Ga0335081_10198363 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300033134|Ga0335073_10080762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4248 | Open in IMG/M |
| 3300033402|Ga0326728_10060314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5274 | Open in IMG/M |
| 3300033402|Ga0326728_10101471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3468 | Open in IMG/M |
| 3300033402|Ga0326728_10119999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3028 | Open in IMG/M |
| 3300033402|Ga0326728_10159960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2406 | Open in IMG/M |
| 3300033891|Ga0334811_006144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 3477 | Open in IMG/M |
| 3300034282|Ga0370492_0403837 | Not Available | 554 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 16.35% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 11.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.85% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| beta3_all_00002070 | 2124908028 | Soil | MGTPDVPEILIGLGLLAGIVWALYNWTHPHVDAPK |
| B_all_v_00123370 | 2140918024 | Soil | PMGTPDVPEILIGLGLVAWLVWALYNWTHPHADAPK |
| JGI12269J14319_100325083 | 3300001356 | Peatlands Soil | MGTLDIPEILIGLGIVGCVIWAFYNWTHPHHGTPK* |
| Ga0070735_100105382 | 3300005534 | Surface Soil | MGSLDLPEVLIVIGLVVAVVWAVYNWTHPHPSAPK* |
| Ga0070730_100105803 | 3300005537 | Surface Soil | MGSLDVPEVLILLGLLACVAWALYHWTHPRPHLPK* |
| Ga0070733_100120034 | 3300005541 | Surface Soil | MGTLDVPEVLILLGLLAGILWGAYNWRHRHMGAPK* |
| Ga0070766_101733893 | 3300005921 | Soil | MAPLDIPEILIAVGIVGCIVWAIYNWTHPHADSHK* |
| Ga0075029_1000251825 | 3300006052 | Watersheds | MGSLDVPEILIVLGLVAGLMWALYNWTHPHPNPPR* |
| Ga0075029_1006052952 | 3300006052 | Watersheds | MRPLDVPEILIALGLVAGLMWAIYNWTHPHPNPPR* |
| Ga0075029_1006070362 | 3300006052 | Watersheds | MRPLDVPEILIVLGLVAGLMWAIYNWTHPHPNPPR* |
| Ga0075017_1002339982 | 3300006059 | Watersheds | MGSLDVPEVLIILGVVAGIVWALYNWKLTHPHRPR* |
| Ga0075030_1003752092 | 3300006162 | Watersheds | MRPLDVPEILILLGVVAGLVWAVYIWTHPHPNRPQ* |
| Ga0070715_103324151 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPLDVPEVLILLGLLIGVVWALYNWTHPHPHPPK* |
| Ga0066659_110582452 | 3300006797 | Soil | MGPLDVPEVLIFLGLVACIVWAVYNWTHPHPHPPK* |
| Ga0073928_106551693 | 3300006893 | Iron-Sulfur Acid Spring | MAALDVPEVLILLGILAIVAWAAYNWTHFRFGKPR* |
| Ga0116107_10468592 | 3300009548 | Peatland | MGTLDVPEILIGLGLVAGLFWALYNWTHPHENAPK* |
| Ga0116125_11366462 | 3300009628 | Peatland | MRPLDVPEILIALGLIATFAWAVYNWKHGTRAPR* |
| Ga0126381_1000594974 | 3300010376 | Tropical Forest Soil | MGNLDVPEILIVIGFAACIAWALYNWTHPHPKQP* |
| Ga0136449_1000496695 | 3300010379 | Peatlands Soil | MGTLDVPEVLIILGVVAGIVWAVYNWKLTHPHQPR* |
| Ga0136449_1003868991 | 3300010379 | Peatlands Soil | MGSLDIPEILIILGILGGIAWGLYNWTHPNMDPRK* |
| Ga0136449_1004302153 | 3300010379 | Peatlands Soil | MAHLDIPEILIALGIVGCIAWAIYNWTRPHTNTPG* |
| Ga0136449_1036161661 | 3300010379 | Peatlands Soil | MATLDVPEILIGLGIVGCIAWAIYNWMHPRTNAPR* |
| Ga0137776_17963962 | 3300010937 | Sediment | MGTLDIPEILIILGLVGGLAWGLYNWTHPHPRPGGQ* |
| Ga0137391_100193414 | 3300011270 | Vadose Zone Soil | MGSLDVPEVLIILGVVVGIAWAVYNWKLTHPHPPK* |
| Ga0137378_101834632 | 3300012210 | Vadose Zone Soil | MGAIDIPEILIGLGVVGCIIWAVYNRTHPRHGATK* |
| Ga0181524_100342832 | 3300014155 | Bog | MGTLDVPEVLIGLGLLAGLFWALYNWTHPHVGTPK* |
| Ga0181521_100126065 | 3300014158 | Bog | MGTPDVPEILIGLGLVAGLIWALYNWTHPHVDAPK* |
| Ga0181517_101243043 | 3300014160 | Bog | MGTLDVPEILILLGILGGIAWAIYNWRHPYRSQRR* |
| Ga0181529_1000029039 | 3300014161 | Bog | MGHLDVPEVLILMGIIGGIAWAIYNWRHPHRERR* |
| Ga0181526_100384902 | 3300014200 | Bog | MRTPDVPEVLIGLGVLAGLFWALYNWTHSRVDTLK* |
| Ga0182017_100433272 | 3300014494 | Fen | MGTLDVPEVLIGLGLLAGLFWALYNWTHPHMNSPK* |
| Ga0182017_108930142 | 3300014494 | Fen | MGTPDVPEILIGLGLLAGIVWALYNWTHPHVDAPK* |
| Ga0182011_100202753 | 3300014496 | Fen | MRYPDVPEVLIALGVVGGIAWAIYNWTHPHRERR* |
| Ga0182011_106477502 | 3300014496 | Fen | MRYPDVPEVLIALGIVGGIAWAIYNWTHPHRERR* |
| Ga0182021_100783363 | 3300014502 | Fen | MRTLDVPEILIGLGLLAGLVWAVYNWTHPHVDAPK* |
| Ga0182021_106320132 | 3300014502 | Fen | MRTLDVPEILIGLGLLAGFIWAVYNWTHPHVDAPK* |
| Ga0182027_100130294 | 3300014839 | Fen | MRYPDVPEVLIVLGILGGIAWAIYNWTHPHRERR* |
| Ga0182027_101757002 | 3300014839 | Fen | MRTPDVPEVLIGLGLLAGLFWAIYNWTHSHAGTPK* |
| Ga0182027_102111743 | 3300014839 | Fen | MGTPDVPEILIGLGLVAGLVWALYNWTHPHVDAPK* |
| Ga0182027_105747902 | 3300014839 | Fen | MRTPDVPEVLIGLGLLAGLLWAIYNWTHSHLGTPK* |
| Ga0182027_105789993 | 3300014839 | Fen | MGTLDVPEVLIGLGLLAGLFWALYNWTHSHVGTPK* |
| Ga0182027_107077363 | 3300014839 | Fen | MRTPDVPEVLIGLGLAAVLFWAIYNWTHSHVGTPK* |
| Ga0181505_104405751 | 3300016750 | Peatland | MRTLDVPEILILLGILGGIAWAVYNWRRPHTGERR |
| Ga0187849_10069585 | 3300017929 | Peatland | MGTLDVPEILIGLGLVAGLFWALYNWTHPHENAPK |
| Ga0187803_100042104 | 3300017934 | Freshwater Sediment | MGALDVPEILIGLGIVACIAWAFYNWTHPRHGVTK |
| Ga0187850_100175383 | 3300017941 | Peatland | MGTLDVPEVLIGLGLLAALAWALYNWSHPHPNAPK |
| Ga0187776_110271761 | 3300017966 | Tropical Peatland | YTVLRRVHMGPLDVPEVLIILGVVAGIVWAVYNWKHAHPHSPK |
| Ga0187780_107184022 | 3300017973 | Tropical Peatland | MGPLDVPEVLIILGIIAGIAWAIYNWTHPHPRLPG |
| Ga0181520_100887062 | 3300017988 | Bog | MRTPDVPEVLIGLGLLAGLFWAVYNWTHSHLGTPK |
| Ga0181520_102766632 | 3300017988 | Bog | MGTLDVPEILILLGILGGIAWAIYNWRHPYRSQRR |
| Ga0187816_105870791 | 3300017995 | Freshwater Sediment | MGPLDVPEVLIILGIIAGIAWAIYNWTHPDPHAPK |
| Ga0187767_100757662 | 3300017999 | Tropical Peatland | MGPLDVPEVLIIVGVVATIAWAVYNWRHTHPHWPK |
| Ga0187889_100072296 | 3300018023 | Peatland | MGTPDVPEILIGLGLVAGIVWALYNWTHPHVDAPK |
| Ga0187794_10595591 | 3300019273 | Peatland | GFMGNLDVPEILIVIGLIGCLAWALHNWRHAHGHHSK |
| Ga0210399_100269132 | 3300020581 | Soil | MGSLDVPEVLIILGVVVGIVWGVYNWRRTHRHSPR |
| Ga0210402_1000006142 | 3300021478 | Soil | MGSLDVPEILIALGLAAGLMWAIHNWTHRRANPPR |
| Ga0210409_116029712 | 3300021559 | Soil | MRPLDVPEILIALGLVAGLMWAIYNWTHPHANPPR |
| Ga0213852_11916382 | 3300021858 | Watersheds | MRPLDVPEILIVLGLVAGLMWAIYNWTHPHPNPPR |
| Ga0213853_104228841 | 3300021861 | Watersheds | MASLDVPEILIVLGVAAGLLWAIYNWTHPHVNPPR |
| Ga0213853_109464552 | 3300021861 | Watersheds | MASLDVPEILIVLGLVAGLMWALYNWTHPHPNPPR |
| Ga0224534_10013966 | 3300022524 | Soil | MGTLDVPEVLIGLGLLAGLFWALYNWTHSHVGTPK |
| Ga0224558_10146803 | 3300023090 | Soil | MRALDVPEMLIGLGLVAGLIWALYNWTHPRVNAPK |
| Ga0209540_100669632 | 3300025888 | Arctic Peat Soil | MGTPDVPEILIGLGLLAGLVWALYNWIHPRVDAPK |
| Ga0209647_12113481 | 3300026319 | Grasslands Soil | VHMGPLDVPEVLILLGLVVCVAWGLYNWMHTHPHLHK |
| Ga0208827_10740232 | 3300027641 | Peatlands Soil | MGTLDIPEILIGLGIVGCVIWAFYNWTHPHHGTPK |
| Ga0209039_1000138114 | 3300027825 | Bog Forest Soil | MRTLDVPEILIGLGLLAGLVWAVYNWTHPHENAPK |
| Ga0209166_100262634 | 3300027857 | Surface Soil | MGSLDVPEVLILLGLLACVAWALYHWTHPRPHLPK |
| Ga0209167_100115414 | 3300027867 | Surface Soil | MGTLDVPEVLILLGLLAGILWGAYNWRHRHMGAPK |
| Ga0209380_102551842 | 3300027889 | Soil | MAPLDIPEILIAVGIVGCIVWAIYNWTHPHADSHK |
| Ga0209067_100002699 | 3300027898 | Watersheds | MGSLDVPEILIVLGLVAGLMWALYNWTHPHPNPPR |
| Ga0209698_103785272 | 3300027911 | Watersheds | MRPLDVPEILILLGVVAGLVWAVYIWTHPHPNRPQ |
| Ga0209698_108444521 | 3300027911 | Watersheds | MRPLDVPEILIALGLVAGLMWAIYNWTHPHPNPPR |
| Ga0209168_100389604 | 3300027986 | Surface Soil | MGSLDLPEVLIVIGLVVAVVWAVYNWTHPHPSAPK |
| Ga0265316_100108696 | 3300031344 | Rhizosphere | MRTPDVPEVLIGLGLLAGLFWAIYNWTHSHAGTPK |
| Ga0265316_100402653 | 3300031344 | Rhizosphere | MRTLDVPEILIGLGLVAGLIWALYNWTHPHIDAPK |
| Ga0265316_103222832 | 3300031344 | Rhizosphere | MQTPDVPEVLIGLGLLAGLFWAIYNWTHSRLGTPK |
| Ga0310813_100805754 | 3300031716 | Soil | MGPLDVPEVLILLGLVACIAWALYNWAHPHTHAPK |
| Ga0311301_100201153 | 3300032160 | Peatlands Soil | MRPLDVPEILIVLGIVGCIIWAVYNWTHPHRRTTK |
| Ga0311301_103037593 | 3300032160 | Peatlands Soil | MAHLDIPEILIALGIVGCIAWAIYNWTRPHTNTPG |
| Ga0311301_105989493 | 3300032160 | Peatlands Soil | MGSLDIPEVLIILGILGGIAWGVYNWTHPNMDLRK |
| Ga0311301_126325612 | 3300032160 | Peatlands Soil | MGSLDIPEILIILGILGEIAWGLYNWTHPSMDPRK |
| Ga0335085_100182037 | 3300032770 | Soil | MRSLDVPEVLIILGILAGLAWAVYNWTHPHASSHK |
| Ga0335085_100741141 | 3300032770 | Soil | MGHLDVPEVLILLGILGGIAWAIYNWRHPQPRARR |
| Ga0335085_101009712 | 3300032770 | Soil | MGSLDVPEILIVMFLFAGLMWAVYNWTHPHVDPPRR |
| Ga0335085_101595812 | 3300032770 | Soil | MSTLDIPEVLILLGIAAGIAWAIYNWTHPHYPTPRR |
| Ga0335085_115668572 | 3300032770 | Soil | MGPLDVPEVLIILGVVAGIVWAVYNWKHAHPHSPK |
| Ga0335085_120286532 | 3300032770 | Soil | MGNLDVPEILILLGLAGCVAWAIYNWTHPRPHIPR |
| Ga0335079_100067267 | 3300032783 | Soil | MHSLDVPEVLIILGILAGLAWAVYNWTHPHASSHK |
| Ga0335079_100080812 | 3300032783 | Soil | MGLLDVPEVLIILGIIAGVAWAIYNWTHPHPHSPR |
| Ga0335079_100413382 | 3300032783 | Soil | MGPLDVPEVLIILGIVAGIVWAVYNWTHPHPHAPK |
| Ga0335079_100449253 | 3300032783 | Soil | MGPLDVPEVLIILGVVAGIVWAVYNWKHSHPHSPR |
| Ga0335079_101471482 | 3300032783 | Soil | MGPLDVPEVLIILGVLAGLAWAVYNWTHPHASSHK |
| Ga0335079_104375363 | 3300032783 | Soil | MAPLDIPEILIAIGILGCIAWGIYNWMHSHHNAHK |
| Ga0335078_100230723 | 3300032805 | Soil | MGHLDVPEVLILLGILGGIAWAIYNWRHPHPRERR |
| Ga0335078_106902812 | 3300032805 | Soil | MGHLDVPEVLILLGILGGIAWAIYNWRHPQPRVRR |
| Ga0335078_109150721 | 3300032805 | Soil | MGTLDVPEILIGLGVVGCIVWAVYNWMHRHQGTTK |
| Ga0335081_101983632 | 3300032892 | Soil | MGPLDVPEILIGIGIIAAAVWAVYNWTHPQPKPSK |
| Ga0335073_100807624 | 3300033134 | Soil | MNSLDVGAVLIILGILGGLAWAVYNRLHSNASERK |
| Ga0326728_100603142 | 3300033402 | Peat Soil | MRTPDVPEILIGLGLVAGLFWALYNWTHPHVDAPK |
| Ga0326728_101014713 | 3300033402 | Peat Soil | MGTPDVPEILIGLGLVAGLIWALYNWTHPHVDAPK |
| Ga0326728_101199992 | 3300033402 | Peat Soil | MRTPDVPEVLIGLGLLAGLFWAVYNWMHSHVGTPK |
| Ga0326728_101599602 | 3300033402 | Peat Soil | MRPLDVPEILIVLGIAGCIVWAVYNWTHPHQRTTK |
| Ga0334811_006144_197_304 | 3300033891 | Soil | MRTPDVPEVLIGVGLLAGLFWAIYNWTHSRLGTPK |
| Ga0370492_0403837_365_472 | 3300034282 | Untreated Peat Soil | MAPLDVPEILIALGIVGCIAWAIYNWAHAHPNTPK |
| ⦗Top⦘ |